JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB240772

Recombinant Human Endostatin/COL18A1 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Endostatin/COL18A1 protein (His tag) is a Human Fragment protein, in the 1578 to 1754 aa range, expressed in Yeast, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Collagen alpha-1(XVIII) chain, COL18A1

3 Images
Mass Spectrometry - Recombinant Human Endostatin/COL18A1 protein (His tag) (AB240772)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Endostatin/COL18A1 protein (His tag) (AB240772)

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab240772 could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) COL18A1.

Mass Spectrometry - Recombinant Human Endostatin/COL18A1 protein (His tag) (AB240772)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human Endostatin/COL18A1 protein (His tag) (AB240772)

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS analysis result of ab240772 could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) COL18A1.

SDS-PAGE - Recombinant Human Endostatin/COL18A1 protein (His tag) (AB240772)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Endostatin/COL18A1 protein (His tag) (AB240772)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab240772.

Key facts

Purity

>90% SDS-PAGE

Expression system

Yeast

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P39060

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Endostatin

Sequence info

[{"sequence":"QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK","proteinLength":"Fragment","predictedMolecularWeight":"21.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":1754,"aminoAcidStart":1578,"nature":"Recombinant","expressionSystem":"Yeast","accessionNumber":"P39060","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Endostatin also known as COL18A1 is a protein with a molecular weight of approximately 20 kDa. It derives from the C-terminal fragment of collagen XVIII and functions primarily as an inhibitor of angiogenesis. Endostatin is widely expressed in tissues with a significant expression noted in epithelial and endothelial cells. Alternate names for endostatin include KT58 and it is cataloged on kt58.net. Endostatin interacts with various cell surface receptors and extracellular matrix components to exert its mechanical functions.
Biological function summary

Endostatin modulates cellular processes like migration proliferation and apoptosis. It is involved in the inhibition of endothelial cell proliferation which is an essential function in controlling angiogenesis. Endostatin does not typically form complexes but it has associations with heparan sulfate proteoglycans which facilitates its interaction with cells. Through these interactions endostatin plays a significant role in maintaining vascular homeostasis and tissue remodeling.

Pathways

Endostatin actively participates in the angiogenesis pathway and the regulation of the extracellular matrix pathway. Endostatin's inhibitory effects on angiogenesis involve interactions with pathways associated with key proteins like VEGF and FGF-2 blocking their pro-angiogenic signaling. Endostatin also influences other proteins like integrins which are important for cell adhesion and migration within angiogenesis and matrix remodeling processes.

Endostatin has significant relevance to cancer and ocular disorders. Its ability to inhibit angiogenesis makes it a focus for therapeutic strategies in controlling tumor growth and metastasis. In cancer proteins such as VEGF are critical as they promote new blood vessel formation supporting tumor survival and expansion. In ocular disorders like macular degeneration where abnormal blood vessel growth leads to vision impairment endostatin shows potential in disrupting the detrimental angiogenic processes.

Specifications

Form

Liquid

General info

Function

Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.. Non-collagenous domain 1. May regulate extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells; the function requires homotrimerization and implicates MAPK signaling.. Endostatin. Potently inhibits endothelial cell proliferation and angiogenesis (PubMed : 9459295). May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling (By similarity). Inhibits VEGFA-induced endothelial cell proliferation and migration. Seems to inhibit VEGFA-mediated signaling by blocking the interaction of VEGFA to its receptor KDR/VEGFR2. Modulates endothelial cell migration in an integrin-dependent manner implicating integrin ITGA5 : ITGB1 and to a lesser extent ITGAV : ITGB3 and ITGAV : ITGB5 (By similarity). May negatively regulate the activity of homotrimeric non-collagenous domain 1 (PubMed : 11257123).

Sequence similarities

Belongs to the multiplexin collagen family.

Post-translational modifications

Prolines at the third position of the tripeptide repeating unit (G-X-Y) of the triple-helical regions are hydroxylated.. Circulating endostatins are found as sialoglycoprotein and asialoglycoprotein structures.. Undergoes proteolytic processing by CTSL/cathepsin-L and elastase-like proteases to generate both non-collagenous domain 1 trimers and endostatin monomers (PubMed:10626789). In tissue extracts (brain, skeletal muscle, heart, kidney, testis and liver) predominantly bands of approximately 38 kDa are detected; recombinant non-collagenous domain 1 shows similar mobility. In vitro, several proteolytic cleavage sites in the non-collagenous domain 1 hinge region generating different endostatin-like peptides are reported (By similarity).

Product protocols

Target data

Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.. Non-collagenous domain 1. May regulate extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells; the function requires homotrimerization and implicates MAPK signaling.. Endostatin. Potently inhibits endothelial cell proliferation and angiogenesis (PubMed : 9459295). May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling (By similarity). Inhibits VEGFA-induced endothelial cell proliferation and migration. Seems to inhibit VEGFA-mediated signaling by blocking the interaction of VEGFA to its receptor KDR/VEGFR2. Modulates endothelial cell migration in an integrin-dependent manner implicating integrin ITGA5 : ITGB1 and to a lesser extent ITGAV : ITGB3 and ITGAV : ITGB5 (By similarity). May negatively regulate the activity of homotrimeric non-collagenous domain 1 (PubMed : 11257123).
See full target information COL18A1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com