JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159085

Recombinant Human ENPP3/B10 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ENPP3/B10 protein (GST tag N-Terminus) is a Human Fragment protein, in the 602 to 699 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

CD203c, PDNP3, ENPP3, Ectonucleotide pyrophosphatase/phosphodiesterase family member 3, E-NPP 3, NPP3, Alkaline phosphodiesterase I, Dinucleoside polyphosphatase, Nucleotide diphosphatase, Nucleotide pyrophosphatase, Phosphodiesterase I beta, Phosphodiesterase I/nucleotide pyrophosphatase 3, NPPase, PD-Ibeta

1 Images
SDS-PAGE - Recombinant Human ENPP3/B10 protein (GST tag N-Terminus) (AB159085)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ENPP3/B10 protein (GST tag N-Terminus) (AB159085)

ab159085 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

O14638

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as ENPP3.

Sequence info

[{"sequence":"ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":699,"aminoAcidStart":602,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O14638","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The ENPP3/B10 protein also known as Ectonucleotide Pyrophosphatase/Phosphodiesterase 3 is an enzyme that plays a role in nucleotide metabolism by hydrolyzing phosphodiester and phosphosulfate bonds. This protein has a molecular mass of around 100 kDa. ENPP3 is mainly expressed on the surface of epithelial cells and you find it in tissues like the kidney liver and lung. In some contexts immune cells such as mast cells also show its expression.
Biological function summary

ENPP3 regulates the availability of extracellular nucleotides and phosphate metabolites. It is not typically considered part of a larger complex and rather contributes to various processes independently. By modulating concentrations of these extracellular molecules ENPP3 impacts cell signaling and nucleotide homeostasis which can affect cell proliferation and differentiation.

Pathways

This enzyme engages in the purinergic signaling pathway and can influence the MAPK/ERK pathway. Through its enzymatic action on nucleotides ENPP3 helps regulate signaling molecules which participate in processes such as cell growth and immune responses. Proteins related to these pathways include ATP-binding proteins like P2Y receptors and kinases involved in MAPK/ERK signaling.

ENPP3's function links it to conditions such as allergy and asthma as its expression on mast cells affects histamine release. Changes in its activity are also noted in certain cancers where its role in signaling pathways can contribute to uncontrolled cell proliferation. In these disease contexts the protein interacts with other signaling molecules like cytokine receptors and oncogenic proteins which can modulate or exacerbate disease progression.

Specifications

Form

Liquid

General info

Function

Hydrolase that metabolizes extracellular nucleotides, including ATP, GTP, UTP and CTP (PubMed : 29717535, PubMed : 9344668). Also hydrolyzes extracellular 2',3'-cGAMP (cyclic GMP-AMP), a second messenger that activates TMEM173/STING and triggers type-I interferon production, and is therefore involved in the regulation of innate immune response (PubMed : 38749434). 2',3'-cGAMP appears to be further processed to GMP, AMP and inorganic phosphate (PubMed : 38749434). Limits mast cells and basophils response during inflammation and during the chronic phases of allergic responses by eliminating extracellular ATP, a signaling molecule activating these cells in an autocrine manner. Metabolizes extracellular ATP in the lumen of the small intestine, and thereby prevents ATP-induced apoptosis of intestinal plasmacytoid dendritic cells (By similarity). Has a broad specificity and can also hydrolyze UDP-GlcNAc into UMP and GlcNAc-1-phosphate and potentially several other intracellular nucleotide sugars, including UDP-GalNAc, CMP-NeuAc, GDP-Fuc, and UDP-GlcA. Thereby, could modulate glycan biosynthesis and protein glycosylation (By similarity). Can hydrolyze extracellular dinucleoside polyphosphates, including the vasoactive adenosine polyphosphates as well (PubMed : 12846830). In addition, displays an alkaline phosphodiesterase activity in vitro (PubMed : 11342463).

Sequence similarities

Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.

Post-translational modifications

N-glycosylated. N-glycosylation is necessary for normal transport to the cell membrane, but is not the apical targeting signal.

Product protocols

Target data

Hydrolase that metabolizes extracellular nucleotides, including ATP, GTP, UTP and CTP (PubMed : 29717535, PubMed : 9344668). Also hydrolyzes extracellular 2',3'-cGAMP (cyclic GMP-AMP), a second messenger that activates TMEM173/STING and triggers type-I interferon production, and is therefore involved in the regulation of innate immune response (PubMed : 38749434). 2',3'-cGAMP appears to be further processed to GMP, AMP and inorganic phosphate (PubMed : 38749434). Limits mast cells and basophils response during inflammation and during the chronic phases of allergic responses by eliminating extracellular ATP, a signaling molecule activating these cells in an autocrine manner. Metabolizes extracellular ATP in the lumen of the small intestine, and thereby prevents ATP-induced apoptosis of intestinal plasmacytoid dendritic cells (By similarity). Has a broad specificity and can also hydrolyze UDP-GlcNAc into UMP and GlcNAc-1-phosphate and potentially several other intracellular nucleotide sugars, including UDP-GalNAc, CMP-NeuAc, GDP-Fuc, and UDP-GlcA. Thereby, could modulate glycan biosynthesis and protein glycosylation (By similarity). Can hydrolyze extracellular dinucleoside polyphosphates, including the vasoactive adenosine polyphosphates as well (PubMed : 12846830). In addition, displays an alkaline phosphodiesterase activity in vitro (PubMed : 11342463).
See full target information ENPP3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com