JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271498

Recombinant human Eph receptor A4/SEK protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Eph receptor A4/SEK protein (Active) is a Human Fragment protein, in the 610 to 887 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

HEK8, SEK, TYRO1, EPHA4, Ephrin type-A receptor 4, EPH-like kinase 8, Tyrosine-protein kinase TYRO1, Tyrosine-protein kinase receptor SEK, EK8, hEK8

2 Images
Functional Studies - Recombinant human Eph receptor A4/SEK protein (Active) (AB271498)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Eph receptor A4/SEK protein (Active) (AB271498)

Specific activity of ab271498 is 61 pmol/min/μg.

SDS-PAGE - Recombinant human Eph receptor A4/SEK protein (Active) (AB271498)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Eph receptor A4/SEK protein (Active) (AB271498)

SDS-PAGE analysis of 1.8 μg ab271498.

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Assay was done in kinase buffer containing 0.2 mM DTT using Poly-(Glu4:Tyr)-biotin substrate (0.2 mg/ml) and 20 μM ATP. Reaction was performed at 30°C for 40 mins. Amount of ATP transferred was calculated using Kinase-Glo reagent.

Specific activity of 61 pmol/mon/μg.

Accession

P54764

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"REFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNS","proteinLength":"Fragment","predictedMolecularWeight":"58 kDa","actualMolecularWeight":null,"aminoAcidEnd":887,"aminoAcidStart":610,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P54764","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Eph receptor A4 also known as SEK is a type of ephrin receptor that plays a significant role in cellular communication. It belongs to the Eph protein family and it is classified as a receptor tyrosine kinase. EphA4 has an approximate molecular mass of 110 kDa. It is mainly expressed in the nervous system although it can also be found in other tissues including the vascular and skeletal systems. This receptor has an important function in mediating signal transduction upon binding with their ephrin ligands.
Biological function summary

EphA4 plays a critical role in developmental processes particularly in the development of the nervous system and vascular patterning. The receptor engages in bidirectional signaling meaning that signals are transmitted not only into the receptor-expressing cells but also into the ephrin-expressing ones. EphA4 is part of complexes that can include multiple receptor and ephrin molecules which allows for the modulation of cell adhesion and migration. These processes are essential for forming tissue boundaries and axon guidance.

Pathways

EphA4 signaling is involved in two significant pathways: the Eph/ephrin signaling pathway and the cytoskeletal remodeling pathway. In the Eph/ephrin signaling pathway EphA4 interacts with various ephrin ligands leading to changes in cellular architecture and behavior. The cytoskeletal remodeling pathway involves interactions with proteins such as Rho and Ras which coordinate cytoskeletal changes necessary for cell movement and positioning. These pathways are integral to processes like axon guidance and cell migration underpinning EphA4’s role in development.

EphA4 has been implicated in conditions such as amyotrophic lateral sclerosis (ALS) and cancer metastasis. In the context of ALS EphA4's interaction with proteins like RhoA affects axonal repair and neuron survival contributing to the disease's progression. Regarding cancer EphA4 influences tumor growth and spread with its signaling pathways impacting cellular invasion and angiogenesis. Understanding these aspects of EphA4 activity assists in developing therapeutic strategies for these disorders.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Receptor tyrosine kinase which binds membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous, it has the unique property among Eph receptors to bind and to be physiologically activated by both GPI-anchored ephrin-A and transmembrane ephrin-B ligands including EFNA1 and EFNB3. Upon activation by ephrin ligands, modulates cell morphology and integrin-dependent cell adhesion through regulation of the Rac, Rap and Rho GTPases activity. Plays an important role in the development of the nervous system controlling different steps of axonal guidance including the establishment of the corticospinal projections. May also control the segregation of motor and sensory axons during neuromuscular circuit development. In addition to its role in axonal guidance plays a role in synaptic plasticity. Activated by EFNA1 phosphorylates CDK5 at 'Tyr-15' which in turn phosphorylates NGEF regulating RHOA and dendritic spine morphogenesis. In the nervous system, also plays a role in repair after injury preventing axonal regeneration and in angiogenesis playing a role in central nervous system vascular formation. Additionally, its promiscuity makes it available to participate in a variety of cell-cell signaling regulating for instance the development of the thymic epithelium. During development of the cochlear organ of Corti, regulates pillar cell separation by forming a ternary complex with ADAM10 and CADH1 which facilitates the cleavage of CADH1 by ADAM10 and disruption of adherens junctions (By similarity). Phosphorylates CAPRIN1, promoting CAPRIN1-dependent formation of a membraneless compartment (By similarity).

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.

Subcellular localisation

Early endosome

Product protocols

Target data

Receptor tyrosine kinase which binds membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous, it has the unique property among Eph receptors to bind and to be physiologically activated by both GPI-anchored ephrin-A and transmembrane ephrin-B ligands including EFNA1 and EFNB3. Upon activation by ephrin ligands, modulates cell morphology and integrin-dependent cell adhesion through regulation of the Rac, Rap and Rho GTPases activity. Plays an important role in the development of the nervous system controlling different steps of axonal guidance including the establishment of the corticospinal projections. May also control the segregation of motor and sensory axons during neuromuscular circuit development. In addition to its role in axonal guidance plays a role in synaptic plasticity. Activated by EFNA1 phosphorylates CDK5 at 'Tyr-15' which in turn phosphorylates NGEF regulating RHOA and dendritic spine morphogenesis. In the nervous system, also plays a role in repair after injury preventing axonal regeneration and in angiogenesis playing a role in central nervous system vascular formation. Additionally, its promiscuity makes it available to participate in a variety of cell-cell signaling regulating for instance the development of the thymic epithelium. During development of the cochlear organ of Corti, regulates pillar cell separation by forming a ternary complex with ADAM10 and CADH1 which facilitates the cleavage of CADH1 by ADAM10 and disruption of adherens junctions (By similarity). Phosphorylates CAPRIN1, promoting CAPRIN1-dependent formation of a membraneless compartment (By similarity).
See full target information EPHA4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com