JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB205990

Recombinant human Eph receptor B2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Eph receptor B2 protein is a Human Fragment protein, in the 611 to 893 aa range, expressed in Baculovirus infected Sf9 cells, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5, EPHB2, Ephrin type-B receptor 2, Developmentally-regulated Eph-related tyrosine kinase, ELK-related tyrosine kinase, EPH tyrosine kinase 3, EPH-like kinase 5, Renal carcinoma antigen NY-REN-47, Tyrosine-protein kinase TYRO5, Tyrosine-protein kinase receptor EPH-3, EK5, hEK5

2 Images
Functional Studies - Recombinant human Eph receptor B2 protein (AB205990)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Eph receptor B2 protein (AB205990)

Sample Kinase Activity Plot. The specific activity of ab205990 was determined to be 220 nmol/min/mg.

SDS-PAGE - Recombinant human Eph receptor B2 protein (AB205990)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Eph receptor B2 protein (AB205990)

SDS-PAGE analysis of ab205990.

Key facts

Purity

>95% Densitometry

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The specific activity of ab205990 was determined to be 220 nmol/min/mg.

Accession

P29323

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"REFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKA","proteinLength":"Fragment","predictedMolecularWeight":"56 kDa","actualMolecularWeight":null,"aminoAcidEnd":893,"aminoAcidStart":611,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P29323","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Eph receptor B2 also known as EphB2 is a member of the Eph receptor family which includes a number of receptor tyrosine kinases. It has a molecular weight of approximately 110 kDa. The B2 receptor is strongly expressed in various tissues including the brain spinal cord and developing embryos. These proteins include the Eph protein as well as other B2 proteins. The receptor plays a mechanical role in guiding cell positioning and tissue patterning by interacting with Ephrin ligands specifically ephrin-B2 and ephrin-B3.
Biological function summary

Eph receptor B2 functions in cell-cell communication and is involved in neuronal navigation and synaptic plasticity. It forms part of a complex that brings together ligand-receptor pairs on adjacent cells facilitating bidirectional signaling. The receptor's activation influences neuronal circuitry remodeling and helps in the differentiation of numerous cell types. The B2 protein acting as anti B2 modulates various cell signaling mechanisms essential for normal physiological functioning especially in the nervous system where it contributes to the intricate network of the eph protein interactions.

Pathways

These interactions place Eph receptor B2 in significant signaling pathways such as the MAPK/ERK and PI3K/Akt pathways. These play influential roles in cell proliferation survival and migration. The receptor interacts with numerous proteins including AB25AP through these pathways affecting developmental processes and mature cellular functions. The precise regulation of these pathways is necessary for maintaining homeostasis in complex biological systems especially within the context of the nervous system.

Alterations in Eph receptor B2 expressions have been linked to conditions such as cancer and Alzheimer’s disease. In cancers overexpression of the B2 receptor can contribute to the abnormal growth and metastasis of tumor cells often through mechanisms involving interactions with other tumorigenic proteins like Eph receptor A2. In Alzheimer's disease changes in B2 receptor signaling are associated with disrupted synaptic plasticity leading to cognitive deficits highlighting the importance of the Eph B2 receptor and its interplay with related signaling proteins in disease pathways.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Functions in axon guidance during development. Involved in the guidance of commissural axons, that form a major interhemispheric connection between the 2 temporal lobes of the cerebral cortex. Also involved in guidance of contralateral inner ear efferent growth cones at the midline and of retinal ganglion cell axons to the optic disk. In addition to axon guidance, also regulates dendritic spines development and maturation and stimulates the formation of excitatory synapses. Upon activation by EFNB1, abolishes the ARHGEF15-mediated negative regulation on excitatory synapse formation. Controls other aspects of development including angiogenesis, palate development and in inner ear development through regulation of endolymph production. Forward and reverse signaling through the EFNB2/EPHB2 complex regulate movement and adhesion of cells that tubularize the urethra and septate the cloaca. May function as a tumor suppressor. May be involved in the regulation of platelet activation and blood coagulation (PubMed : 30213874).

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.

Post-translational modifications

Autophosphorylated; ligand binding stimulates autophosphorylation on tyrosine residues.. Polyubiquitinated; ligand binding stimulates ubiquitination (PubMed:28931592). Ubiquitinated by RNF186 at Lys-891, mainly through 'Lys-27'-linked polyubiquitin chains (PubMed:33280498).. Ligand binding induces cleavage by matrix metalloproteinases (MMPs) such as MMP7/MMP9, producing an EphB2/N-terminal fragment (NTF) and a C-terminal long fragment (EphB2-LF). EphB2-LF is further cleaved by MMPs, producing EphB2/CTF1 which is further cleaved by the PS1/gamma-secretase producing EphB2/CTF2.

Product protocols

Target data

Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Functions in axon guidance during development. Involved in the guidance of commissural axons, that form a major interhemispheric connection between the 2 temporal lobes of the cerebral cortex. Also involved in guidance of contralateral inner ear efferent growth cones at the midline and of retinal ganglion cell axons to the optic disk. In addition to axon guidance, also regulates dendritic spines development and maturation and stimulates the formation of excitatory synapses. Upon activation by EFNB1, abolishes the ARHGEF15-mediated negative regulation on excitatory synapse formation. Controls other aspects of development including angiogenesis, palate development and in inner ear development through regulation of endolymph production. Forward and reverse signaling through the EFNB2/EPHB2 complex regulate movement and adhesion of cells that tubularize the urethra and septate the cloaca. May function as a tumor suppressor. May be involved in the regulation of platelet activation and blood coagulation (PubMed : 30213874).
See full target information EPHB2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com