JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113867

Recombinant Human Ephrin A1 protein (denatured)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Ephrin A1 protein (denatured) is a Human Full Length protein, in the 19 to 182 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

EPLG1, LERK1, TNFAIP4, EFNA1, Ephrin-A1, EPH-related receptor tyrosine kinase ligand 1, Immediate early response protein B61, Tumor necrosis factor alpha-induced protein 4, LERK-1, TNF alpha-induced protein 4

1 Images
SDS-PAGE - Recombinant Human Ephrin A1 protein (denatured) (AB113867)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Ephrin A1 protein (denatured) (AB113867)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P20827

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMDRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDPEVRVLHSIGHS","proteinLength":"Full Length","predictedMolecularWeight":"21.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":182,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P20827","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Ephrin A1 also known as EFNA1 is a membrane-bound ligand that belongs to the ephrin family of proteins. It has a mass of approximately 22 kDa. Ephrin A1 engages in the binding and activation of Eph receptors particularly EphA2 which mediates bidirectional signaling between cells. This protein is widely expressed in various tissues including the adult brain lungs and liver. It plays a significant role in cell-cell communication especially during developmental processes.
Biological function summary

Ephrin A1 contributes to the regulation of cell movement and adhesion. It often forms part of a receptor-ligand complex with Eph receptors on adjacent cells. This interaction controls the guidance of axonal growth angiogenesis and tissue boundary formation. In the nervous system ephrin A1 influences the segregation of synaptic connections playing a role in developing the proper neural circuitry. Its expression patterns suggest its involvement in vascular processes and other critical physiological functions.

Pathways

Ephrin A1 is significantly involved in various signaling pathways that mediate cellular attachment and repulsion features. Notably it participates in the Eph/ephrin signaling and the Rho family GTPase signaling pathways. Through its interaction with the EphA2 receptor ephrin A1 regulates cytoskeletal dynamics and influences both integrin-mediated adhesion and cell migration. These pathways are important for maintaining cellular architecture and orchestrating cellular responses to environmental cues.

Ephrin A1 has been implicated in several pathological conditions notably breast cancer and glioblastoma. It interacts with the EphA2 receptor which is overexpressed in these cancers contributing to tumor development and progression. It is also associated with cancer-related proteins involved in metastatic signaling. Studies show that disrupted ephrin A1/EphA2 interactions can affect tumor angiogenesis and cellular proliferation highlighting its potential as a target for therapeutic intervention in cancer biology.

Specifications

Form

Liquid

General info

Function

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.

Sequence similarities

Belongs to the ephrin family.

Post-translational modifications

Undergoes proteolysis by a metalloprotease to give rise to a soluble monomeric form.. N-Glycosylation is required for binding to EPHA2 receptor and inducing its internalization.

Product protocols

Target data

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.
See full target information EFNA1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com