JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB211321

Recombinant Human EPO-R protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human EPO-R protein (His tag C-Terminus) is a Human Fragment protein, in the 25 to 250 aa range, expressed in Insect cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Erythropoietin receptor, EPO-R, EPOR

1 Images
SDS-PAGE - Recombinant Human EPO-R protein (AB211321)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human EPO-R protein (AB211321)

15% SDS-PAGE analysis of ab211321 (3μg). Molecular weight is 28-40kDa on SDS-PAGE under reducing conditions.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P19235

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as EPO Receptor.

Sequence info

[{"sequence":"APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"25.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":250,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Insect cells","accessionNumber":"P19235","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Erythropoietin receptor (EPO-R) also known as EPOR plays an important role in erythropoiesis by mediating the effects of erythropoietin (EPO). EPO-R is a member of the cytokine receptor family with a mass of approximately 55 kDa. This receptor can primarily be found on the surface of erythroid progenitor cells in the bone marrow. Its presence is important for the final differentiation of these cells into mature erythrocytes.
Biological function summary

EPO-R functions by dimerizing upon EPO binding subsequently activating intracellular signaling pathways. It is a component of a larger signaling complex that recruits and activates various molecules initiating a cascade of events critical for cell survival and proliferation. This receptor signaling prevents apoptosis in erythroid progenitor cells promoting their growth and differentiation into red blood cells.

Pathways

EPO-R's activity falls within the JAK-STAT and PI3K-AKT signaling pathways. These pathways are pivotal in regulating hematopoiesis and cell survival. JAK2 acts as a direct partner to EPO-R and transduces the signal downstream while molecules like STAT5 get phosphorylated and mediate transcription of target genes. The PI3K-AKT pathway also contributes to the anti-apoptotic effect essential for erythrocyte development.

Altered EPO-R signaling associates with anemia of chronic disease and polycythemia vera. Anemic conditions often show reduced sensitivity or expression of EPO-R while mutations leading to EPO-R hypersensitivity link to polycythemia vera. Dysregulation of related proteins such as JAK2 also contributes to these conditions indicating the interconnected roles of these proteins in blood-related diseases.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Receptor for erythropoietin, which mediates erythropoietin-induced erythroblast proliferation and differentiation (PubMed : 10388848, PubMed : 2163695, PubMed : 2163696, PubMed : 8662939, PubMed : 9774108). Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade (By similarity). In some cell types, can also activate STAT1 and STAT3 (PubMed : 11756159). May also activate the LYN tyrosine kinase (By similarity).. Isoform EPOR-T. Acts as a dominant-negative receptor of EPOR-mediated signaling.

Sequence similarities

Belongs to the type I cytokine receptor family. Type 1 subfamily.

Post-translational modifications

On EPO stimulation, phosphorylated on C-terminal tyrosine residues by JAK2 (PubMed:11781573). The phosphotyrosine motifs are also recruitment sites for several SH2-containing proteins and adapter proteins which mediate cell proliferation (PubMed:10374881). Phosphorylation on Tyr-454 is required for PTPN6 interaction, Tyr-426 for PTPN11 (By similarity). Tyr-426 is also required for SOCS3 binding, but Tyr-454/Tyr-456 motif is the preferred binding site (PubMed:12027890).. Ubiquitinated by the ECS(SOCS2) complex following ligand-binding and phosphorylation by JAK2, leading to its degradation by the proteasome (PubMed:11781573, PubMed:31182716). Regulation by the ECS(SOCS2) complex acts as a negative feedback loop of erythropoietin-mediated signaling pathway (PubMed:11781573). Ubiquitination at Lys-281 mediates receptor internalization, whereas ubiquitination at Lys-453 promotes trafficking of activated receptors to the lysosomes for degradation (By similarity). Ubiquitinated by NOSIP; appears to be either multi-monoubiquitinated or polyubiquitinated (PubMed:12746455). Ubiquitination mediates proliferation and survival of EPO-dependent cells (By similarity).

Product protocols

Target data

Receptor for erythropoietin, which mediates erythropoietin-induced erythroblast proliferation and differentiation (PubMed : 10388848, PubMed : 2163695, PubMed : 2163696, PubMed : 8662939, PubMed : 9774108). Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade (By similarity). In some cell types, can also activate STAT1 and STAT3 (PubMed : 11756159). May also activate the LYN tyrosine kinase (By similarity).. Isoform EPOR-T. Acts as a dominant-negative receptor of EPOR-mediated signaling.
See full target information EPOR

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com