JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB270597

Recombinant Human ErbB2 / HER2 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ErbB2 / HER2 protein (Tagged) is a Human Fragment protein, in the 376 to 578 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD340, HER2, MLN19, NEU, NGL, ERBB2, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, MLN 19

1 Images
SDS-PAGE - Recombinant Human ErbB2 / HER2 protein (Tagged) (AB270597)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human ErbB2 / HER2 protein (Tagged) (AB270597)

Recombinant human ErbB 2 protein fragment (ab270597) resolved on a 15% SDS-PAGE gel under reducing conditions.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

GST tag N-Terminus His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P04626

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Storage buffer

Constituents: PBS, 82.8% Trehalose, 0.17% Sodium-N-Lauroylsarcosinate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFG","proteinLength":"Fragment","predictedMolecularWeight":"137 kDa","actualMolecularWeight":"54 kDa","aminoAcidEnd":578,"aminoAcidStart":376,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P04626","tags":[{"tag":"GST","terminus":"N-Terminus"},{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The ErbB2 also known as HER2 or HER2 protein is a transmembrane receptor protein with a molecular weight of about 185 kDa. It serves as part of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. The ErbB2 protein is expressed mainly in epithelial tissues including those of the breast and the gastrointestinal tract. It lacks a known ligand-binding domain which sets it apart from other members of its family. Due to its structure ErbB2 dimerizes with other members of the EGFR family to exert its effects in cellular signaling.
Biological function summary

The role of ErbB2 extends beyond a singular function. It becomes an active component when forming heterodimers with other EGFR family members such as ErbB3 to initiate various downstream signaling cascades. The dimerization activates intracellular pathways leading to cell proliferation survival differentiation and migration. Within cells ErbB2 influences processes critical for normal development and tissue homeostasis contributing significantly to signal transduction networks.

Pathways

ErbB2 plays a pivotal role in pathways such as the PI3K/Akt and MAPK/ERK pathways. These pathways are important in mediating cellular responses to growth signals. The PI3K/Akt pathway activated by HER2 signaling regulates cell growth and survival while the MAPK/ERK pathway contributes to cell differentiation and proliferation. ErbB2's interaction with proteins like ErbB3 is fundamental in these pathways increasing the amplitude and diversity of downstream signals.

ErbB2 is significantly associated with breast cancer and gastric cancer. The overexpression or gene amplification of HER2 is observed in approximately 20% of breast cancer cases correlating with aggressive tumor growth and poor prognosis. ErbB2-related signaling contributes to oncogenic processes by promoting excessive cell proliferation. Targeting ErbB2 in these cancers is common using therapies such as monoclonal antibodies like trastuzumab. In the context of gastric cancer the role of ErbB2 mirrors its function in breast cancer and targeting HER2 holds therapeutic potential.

Specifications

Form

Lyophilized

Additional notes

nan

General info

Function

Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.. In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.

Post-translational modifications

Autophosphorylated. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit (Probable). Ligand-binding increases phosphorylation on tyrosine residues (PubMed:27134172, PubMed:33497358). Signaling via SEMA4C promotes phosphorylation at Tyr-1248 (PubMed:17554007). Dephosphorylated by PTPN12 (PubMed:27134172).

Subcellular localisation

Early endosome

Product protocols

Target data

Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.. In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.
See full target information ERBB2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com