JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152370

Recombinant Human Estrogen Related Receptor alpha protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Estrogen Related Receptor alpha protein is a Human Fragment protein, in the 231 to 330 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

ERR1, ESRL1, NR3B1, ESRRA, Steroid hormone receptor ERR1, Estrogen receptor-like 1, Estrogen-related receptor alpha, Nuclear receptor subfamily 3 group B member 1, ERR-alpha

1 Images
SDS-PAGE - Recombinant Human Estrogen Related Receptor alpha protein (AB152370)
  • SDS-PAGE

Unknown

12.5% SDS-PAGE analysis of ab152370 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

P11474

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"LFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLK","proteinLength":"Fragment","predictedMolecularWeight":"36.74 kDa","actualMolecularWeight":null,"aminoAcidEnd":330,"aminoAcidStart":231,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P11474","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Estrogen Related Receptor Alpha (ERRα) also known as NR3B1 is an orphan nuclear receptor with a molecular mass of approximately 51 kDa. It acts as a transcription factor and influences the expression of genes involved in energy metabolism. ERRα is expressed in numerous tissues such as the liver heart kidney and skeletal muscles. It binds to DNA as a monomer and alters specific gene expression activities. This protein lacks an identified ligand which classifies it as an orphan receptor but it shares structural similarities with estrogen receptors allowing the regulation of gene transcription in several physiological contexts.
Biological function summary

Estrogen Related Receptor Alpha regulates cellular energy production processes including mitochondrial biogenesis and oxidative phosphorylation. It plays a role in the biological function of energy homeostasis and increases the expression of genes related to metabolic processes. ERRα operates as part of a transcriptional regulatory network and interacts with other nuclear receptors and coactivators to modulate its activity. It often forms complexes with coactivators such as peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1α) to exert its effects on mitochondrial function.

Pathways

ERRα is integral to the PGC-1α signaling pathway and the AMPK (AMP-activated protein kinase) signaling pathway. These pathways are important in regulating energy metabolism and adaptive thermogenesis. ERRα interacts with PGC-1α to enhance mitochondrial function and energy expenditure while AMPK activation affects ERRα transcriptional activity and facilitates cellular energy balance. Additionally ERRα cross-talks with other nuclear receptors like PPAR (peroxisome proliferator-activated receptor) family members which are involved in lipid metabolism and glucose homeostasis.

ERRα has implications in metabolic conditions such as diabetes and obesity. The protein links to diabetes through its role in mitochondrial dysfunction and insulin resistance. Obesity-related studies point out how ERRα affects adaptive thermogenesis and lipid metabolism contributing to energy imbalance. ERRα-PPAR interactions highlight its association in metabolic disorders influencing various aspects of metabolism and disease progression. Understanding ERRα function offers therapeutic potential for targeting metabolic diseases.

Specifications

Form

Liquid

General info

Function

Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. Binds to the C1 region of the lactoferrin gene promoter. Requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism. Induces the expression of PERM1 in the skeletal muscle.

Sequence similarities

Belongs to the nuclear hormone receptor family. NR3 subfamily.

Post-translational modifications

Phosphorylation on Ser-19 enhances sumoylation on Lys-14 increasing repression of transcriptional activity.. Sumoylated with SUMO2. Main site is Lys-14 which is enhanced by phosphorylation on Ser-19, cofactor activation, and by interaction with PIAS4. Sumoylation enhances repression of transcriptional activity, but has no effect on subcellular location nor on DNA binding.. Reversibly acetylated. Acetylation by PCAF/KAT2 at Lys-129, Lys-138, Lys-160 and Lys-162 and PCAF/KAT2 decreases transcriptional activity probably by inhibiting DNA-binding activity; deacetylation involves SIRT1 and HDAC8 and increases DNA-binding.

Subcellular localisation

Nucleus

Product protocols

Target data

Binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TNAAGGTCA-3'. Can bind to the medium-chain acyl coenzyme A dehydrogenase (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. Binds to the C1 region of the lactoferrin gene promoter. Requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism. Induces the expression of PERM1 in the skeletal muscle.
See full target information ESRRA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com