JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB196413

Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) is a Human Full Length protein, in the 2 to 425 aa range, expressed in Baculovirus infected Sf9 cells, with >79%, suitable for SDS-PAGE, FuncS.

View Alternative Names

RBAP48, RBBP4, Histone-binding protein RBBP4, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, Nucleosome-remodeling factor subunit RBAP48, Retinoblastoma-binding protein 4, Retinoblastoma-binding protein p48, CAF-1 subunit C, CAF-I 48 kDa subunit, CAF-I p48, RBBP-4, CHET9, JJAZ1, KIAA0160, SUZ12, Polycomb protein SUZ12, Chromatin precipitated E2F target 9 protein, Joined to JAZF1 protein, Suppressor of zeste 12 protein homolog, ChET 9 protein, Polycomb protein EED, hEED, Embryonic ectoderm development protein, WD protein associating with integrin cytoplasmic tails 1, WAIT-1, EED, KIAA0388, EZH1, Histone-lysine N-methyltransferase EZH1, ENX-2, Enhancer of zeste homolog 1, Zinc finger protein AEBP2, Adipocyte enhancer-binding protein 2, AE-binding protein 2, AEBP2

2 Images
Functional Studies - Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) (AB196413)
  • FuncS

Unknown

Functional Studies - Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) (AB196413)

Specific activity of ab196413.

SDS-PAGE - Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) (AB196413)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human EZH1 + EED + SUZ12 + RBBP4 + AEBP2 protein (Active) (His N-Term, DDDDK N-Term) (AB196413)

SDS-PAGE analysis of ab196413.

Key facts

Purity

>79% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

50 μl reaction mix (20 mM phosphate pH 7.4, 0.05% Tween-20, 40 μM S-adenosylmethionine, and ab196413 were added to the wells coated with the substrate on a Neutravidin white plate. Incubated for 1 hr. Added antibody against methylated K27 residue of histone H3, incubated 1 hr. Then, added secondary HRP-labeled antibody and incubated 30 min. Finally, added HRP chemiluminescent substrates and read luminescence.

Accession

Q09028

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Preservative: 1.36% Imidazole Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":425,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q09028","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"SEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":441,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"O75530","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]},{"sequence":"APQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":739,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q15022","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"AAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEAEAVAALLLNGGSGGGGGGGGGGVGGGEAETMSEPSPESASQAGEDEDEEEDDEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":503,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q6ZN18","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"EIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":747,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q92800","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The EZH1 EED SUZ12 RBBP4 and AEBP2 proteins form the core of Polycomb Repressive Complex 2 (PRC2) which is an essential multi-subunit protein assembly. The main function of PRC2 lies in its ability to methylate histone H3 on lysine 27 (H3K27me3) an important histone modification promoting chromatin compaction and gene silencing. The molecular weight of each subunit varies with EZH1 around 85 kDa. The PRC2 components such as EZH1 mostly express in tissues where epigenetic regulation is required including embryonic stem cells and various somatic tissues.
Biological function summary

This complex plays a significant role in maintaining transcriptional repression across the genome contributing to cellular identity and stem cell pluripotency. PRC2 including the catalytic subunit EZH1 and its accessory proteins EED SUZ12 RBBP4 and AEBP2 facilitates chromatin remodeling and maintenance of gene silencing by regulating the histone methylation status. This biological mechanism influences differentiation pathways and is important in preserving a balance between cell proliferation and specialization.

Pathways

EZH1 and its associated complex modulate important developmental and signaling pathways such as the Wnt and Notch pathways. PRC2 works closely with other chromatin modifiers and regulators like HDAC1/2 contributing to the fine-tuning of gene expression during development and cellular differentiation. These pathways are integral to the regulation of cell fate decisions and PRC2's activity ensures proper pathway signaling through chromatin-mediated control.

Abnormalities in EZH1 and associated PRC2 components link to certain cancers especially leukemia and breast cancer. Mutations or altered expression levels of PRC2 subunits influence chromatin structure and gene regulation potentially leading to oncogenesis. These components interact with other proteins such as DNMT3A and TET2 which also play roles in epigenetic modifications and cancer development. Understanding the relationship between PRC2 and disease offers potential therapeutic avenues for targeting these pathways in cancer treatment.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA (PubMed : 10866654). Component of the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair (PubMed : 8858152). Component of the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression (PubMed : 9150135). Component of the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling (PubMed : 16428440, PubMed : 28977666, PubMed : 39460621). Component of the PRC2 complex, which promotes repression of homeotic genes during development (PubMed : 29499137, PubMed : 31959557). Component of the NURF (nucleosome remodeling factor) complex (PubMed : 14609955, PubMed : 15310751).

Sequence similarities

Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.

Product protocols

Target data

Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA (PubMed : 10866654). Component of the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair (PubMed : 8858152). Component of the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression (PubMed : 9150135). Component of the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling (PubMed : 16428440, PubMed : 28977666, PubMed : 39460621). Component of the PRC2 complex, which promotes repression of homeotic genes during development (PubMed : 29499137, PubMed : 31959557). Component of the NURF (nucleosome remodeling factor) complex (PubMed : 14609955, PubMed : 15310751).
See full target information RBBP4

Additional targets

EED,SUZ12,AEBP2,EZH1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com