JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198082

Recombinant Human EZH2 (mut Y641H) + EED + SUZ12 + AEBP2 + RBBP4 protein (His N-Term, DDDDK N-Term)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human EZH2 (mut Y641H) + EED + SUZ12 + AEBP2 + RBBP4 protein (His N-Term, DDDDK N-Term) is a Human Full Length protein, in the 2 to 425 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

KMT6, EZH2, Histone-lysine N-methyltransferase EZH2, ENX-1, Enhancer of zeste homolog 2, Lysine N-methyltransferase 6, CHET9, JJAZ1, KIAA0160, SUZ12, Polycomb protein SUZ12, Chromatin precipitated E2F target 9 protein, Joined to JAZF1 protein, Suppressor of zeste 12 protein homolog, ChET 9 protein, RBAP48, RBBP4, Histone-binding protein RBBP4, Chromatin assembly factor 1 subunit C, Chromatin assembly factor I p48 subunit, Nucleosome-remodeling factor subunit RBAP48, Retinoblastoma-binding protein 4, Retinoblastoma-binding protein p48, CAF-1 subunit C, CAF-I 48 kDa subunit, CAF-I p48, RBBP-4, Polycomb protein EED, hEED, Embryonic ectoderm development protein, WD protein associating with integrin cytoplasmic tails 1, WAIT-1, EED, Zinc finger protein AEBP2, Adipocyte enhancer-binding protein 2, AE-binding protein 2, AEBP2

1 Images
SDS-PAGE - Recombinant Human EZH2 (mut Y641H) + EED + SUZ12 + AEBP2 + RBBP4 protein (His N-Term, DDDDK N-Term) (AB198082)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human EZH2 (mut Y641H) + EED + SUZ12 + AEBP2 + RBBP4 protein (His N-Term, DDDDK N-Term) (AB198082)

10% gradient SDS-PAGE analysis of ab198082 (4 μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q15910

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Preservative: 1.36% Imidazole Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS","proteinLength":"Full Length","predictedMolecularWeight":"48 kDa","actualMolecularWeight":null,"aminoAcidEnd":425,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q09028","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"SEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR","proteinLength":"Full Length","predictedMolecularWeight":"51 kDa","actualMolecularWeight":null,"aminoAcidEnd":441,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"O75530","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]},{"sequence":"AAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEEEEEEEEAEAEAVAALLLNGGSGGGGGGGGGGVGGGEAETMSEPSPESASQAGEDEDEEEDDEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSLSPGAASSSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR","proteinLength":"Full Length","predictedMolecularWeight":"53 kDa","actualMolecularWeight":null,"aminoAcidEnd":503,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q6ZN18","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"GQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEHCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP","proteinLength":"Full Length","predictedMolecularWeight":"86 kDa","actualMolecularWeight":null,"aminoAcidEnd":751,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q15910","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"APQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL","proteinLength":"Full Length","predictedMolecularWeight":"87 kDa","actualMolecularWeight":null,"aminoAcidEnd":739,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"Q15022","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein complex EZH2 + EED + SUZ12 + AEBP2 + RBBP4 often referred to as the Polycomb Repressive Complex 2 (PRC2) performs essential functions in chromatin remodeling. EZH2 the catalytic subunit carries out histone methylation specifically trimethylation of lysine 27 on histone H3 (H3K27me3) which leads to transcriptional repression. The full complex is a significant entity with variable mass between 200-700 kDa due to different interacting partners and post-translational modifications. PRC2's component proteins are widely expressed across different tissues playing integral roles in cellular processes.
Biological function summary

The PRC2 complex regulates gene silencing important during development and differentiation. It forms a multiprotein complex where EZH2 works intimately with EED and SUZ12 to mediate its methyltransferase activity while AEBP2 and RBBP4 stabilize the complex and assist in DNA binding. The precise modulation of gene expression through PRC2 ensures correct lineage specification maintaining stem cell pluripotency and directing cellular differentiation.

Pathways

The Polycomb Repressive Complex 2 influences major signaling networks such as the Wnt signaling and cell cycle regulation pathways. In the Wnt signaling pathway PRC2 interacts with other proteins like β-catenin to control transcription of target genes. Additionally in cell cycle regulation PRC2 modifies chromatin structures to repress genes essential for cell division when necessary. These interactions help maintain homeostasis and physiological balance in the cell.

PRC2 is linked to various cancers and developmental syndromes. Dysregulated EZH2 activity through overexpression or mutation often associates with malignancies like prostate cancer and lymphoma where it aberrantly silences tumor suppressor genes. Additionally PRC2 involvement has been noted in Weaver syndrome a developmental disorder connected with mutations in its components. The misregulation of PRC2 affects other proteins and pathways implicating it in complex disease mechanisms.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Catalytic subunit of the PRC2/EED-EZH2 complex, a Polycomb group (PcG) complex that methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene (PubMed : 14532106, PubMed : 15225548, PubMed : 15385962, PubMed : 16618801, PubMed : 16936726, PubMed : 17344414, PubMed : 22323599, PubMed : 24474760, PubMed : 26581166, PubMed : 30026490, PubMed : 30923826). Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively (PubMed : 15231737, PubMed : 17210787, PubMed : 18285464, PubMed : 22323599, PubMed : 30923826). Displays a preference for substrates with less methylation, loses activity when progressively more methyl groups are incorporated into H3K27, H3K27me0 > H3K27me1 > H3K27me2 (PubMed : 22323599, PubMed : 30923826). Compared to EZH1-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation (PubMed : 19026781). The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems (PubMed : 16357870, PubMed : 17200670). Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1, CDKN2A and retinoic acid target genes (PubMed : 16179254, PubMed : 18086877, PubMed : 20935635). EZH2 can also methylate non-histone proteins such as the transcription factor GATA4 and the nuclear receptor RORA (PubMed : 23063525). Regulates the circadian clock via histone methylation at the promoter of the circadian genes (PubMed : 16717091). Essential for the CRY1/2-mediated repression of the transcriptional activation of PER1/2 by the CLOCK-BMAL1 heterodimer; involved in the di and trimethylation of 'Lys-27' of histone H3 on PER1/2 promoters which is necessary for the CRY1/2 proteins to inhibit transcription (By similarity).

Sequence similarities

Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. EZ subfamily.

Post-translational modifications

Phosphorylated by AKT1. Phosphorylation by AKT1 reduces methyltransferase activity. Phosphorylation at Thr-345 by CDK1 and CDK2 promotes maintenance of H3K27me3 levels at EZH2-target loci, thus leading to epigenetic gene silencing.. Sumoylated.. Glycosylated: O-GlcNAcylation at Ser-75 by OGT increases stability of EZH2 and facilitates the formation of H3K27me3 by the PRC2/EED-EZH2 complex.

Product protocols

Target data

Catalytic subunit of the PRC2/EED-EZH2 complex, a Polycomb group (PcG) complex that methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene (PubMed : 14532106, PubMed : 15225548, PubMed : 15385962, PubMed : 16618801, PubMed : 16936726, PubMed : 17344414, PubMed : 22323599, PubMed : 24474760, PubMed : 26581166, PubMed : 30026490, PubMed : 30923826). Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively (PubMed : 15231737, PubMed : 17210787, PubMed : 18285464, PubMed : 22323599, PubMed : 30923826). Displays a preference for substrates with less methylation, loses activity when progressively more methyl groups are incorporated into H3K27, H3K27me0 > H3K27me1 > H3K27me2 (PubMed : 22323599, PubMed : 30923826). Compared to EZH1-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation (PubMed : 19026781). The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems (PubMed : 16357870, PubMed : 17200670). Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1, CDKN2A and retinoic acid target genes (PubMed : 16179254, PubMed : 18086877, PubMed : 20935635). EZH2 can also methylate non-histone proteins such as the transcription factor GATA4 and the nuclear receptor RORA (PubMed : 23063525). Regulates the circadian clock via histone methylation at the promoter of the circadian genes (PubMed : 16717091). Essential for the CRY1/2-mediated repression of the transcriptional activation of PER1/2 by the CLOCK-BMAL1 heterodimer; involved in the di and trimethylation of 'Lys-27' of histone H3 on PER1/2 promoters which is necessary for the CRY1/2 proteins to inhibit transcription (By similarity).
See full target information EZH2 mutated Y641H

Additional targets

EED,RBBP4,SUZ12,AEBP2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com