JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276309

Recombinant human Factor H protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Factor H protein (His tag) is a Human Fragment protein, in the 860 to 1231 aa range, expressed in HEK 293 cells, with >97%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

HF, HF1, HF2, CFH, Complement factor H, H factor 1

2 Images
Functional Studies - Recombinant human Factor H protein (His tag) (AB276309)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Factor H protein (His tag) (AB276309)

Measured by its ability to bind biotinylated human DMP1 in a functional ELISA.

SDS-PAGE - Recombinant human Factor H protein (His tag) (AB276309)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human Factor H protein (His tag) (AB276309)

SDS-PAGE analysis of ab276309

Key facts

Purity

>97% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Measured by its ability to bind biotinylated human DMP1 in a functional ELISA.

Accession

P08603

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR","proteinLength":"Fragment","predictedMolecularWeight":"43 kDa","actualMolecularWeight":null,"aminoAcidEnd":1231,"aminoAcidStart":860,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P08603","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Factor H also known as complement factor H is an important regulatory protein in the complement system. It has a molecular mass of approximately 155 kDa. This protein is mainly expressed in the liver but it can also be found in low levels in other tissues. Factor H serves as a control element for complement activation particularly affecting the alternative pathway. It binds to C3b a central component of the complement system and accelerates the decay of C3 convertase as well as promotes the proteolytic inactivation of C3b by factor I.
Biological function summary

Factor H limits the activity of the complement system to prevent damage to host tissues. The protein exists in the plasma in a soluble form. It functions by recognizing host cell surfaces via specific markers avoiding inappropriate activation. Factor H belongs to a group of proteins which include other regulators of complement activation. These proteins maintain the balance between effective immune defense and protection of host tissue from excessive immune responses.

Pathways

Factor H is a part of the alternative complement pathway. This pathway is important for innate immune response involving proteins like factor P (properdin) which stabilizes C3 convertase. Factor H modulates these interactions to prevent unwarranted complement activity on host cells. Another related pathway is the classic complement pathway although factor H's involvement here is less direct since it primarily regulates the alternative pathway.

Factor H associations include atypical hemolytic uremic syndrome and age-related macular degeneration. Factor H deficiency or dysfunction can lead to uncontrolled complement activation resulting in kidney damage in atypical hemolytic uremic syndrome where it is also related to factor I. Additionally in age-related macular degeneration variants in the factor H gene are linked to increased susceptibility further highlighting the protein's importance in regulating immune responses.

Specifications

Form

Lyophilized

General info

Function

Glycoprotein that plays an essential role in maintaining a well-balanced immune response by modulating complement activation. Acts as a soluble inhibitor of complement, where its binding to self markers such as glycan structures prevents complement activation and amplification on cell surfaces (PubMed : 21285368, PubMed : 25402769). Accelerates the decay of the complement alternative pathway (AP) C3 convertase C3bBb, thus preventing local formation of more C3b, the central player of the complement amplification loop (PubMed : 19503104, PubMed : 26700768). As a cofactor of the serine protease factor I, CFH also regulates proteolytic degradation of already-deposited C3b (PubMed : 18252712, PubMed : 23332154, PubMed : 28671664). In addition, mediates several cellular responses through interaction with specific receptors. For example, interacts with CR3/ITGAM receptor and thereby mediates the adhesion of human neutrophils to different pathogens. In turn, these pathogens are phagocytosed and destroyed (PubMed : 20008295, PubMed : 9558116).. (Microbial infection) In the mosquito midgut, binds to the surface of parasite P.falciparum gametocytes and protects the parasite from alternative complement pathway-mediated elimination.

Post-translational modifications

Sulfated on tyrosine residues.. According to a report, Asn-217 is not glycosylated (PubMed:17591618). Another study observed glycosylation at this position (PubMed:19139490).

Product protocols

Target data

Glycoprotein that plays an essential role in maintaining a well-balanced immune response by modulating complement activation. Acts as a soluble inhibitor of complement, where its binding to self markers such as glycan structures prevents complement activation and amplification on cell surfaces (PubMed : 21285368, PubMed : 25402769). Accelerates the decay of the complement alternative pathway (AP) C3 convertase C3bBb, thus preventing local formation of more C3b, the central player of the complement amplification loop (PubMed : 19503104, PubMed : 26700768). As a cofactor of the serine protease factor I, CFH also regulates proteolytic degradation of already-deposited C3b (PubMed : 18252712, PubMed : 23332154, PubMed : 28671664). In addition, mediates several cellular responses through interaction with specific receptors. For example, interacts with CR3/ITGAM receptor and thereby mediates the adhesion of human neutrophils to different pathogens. In turn, these pathogens are phagocytosed and destroyed (PubMed : 20008295, PubMed : 9558116).. (Microbial infection) In the mosquito midgut, binds to the surface of parasite P.falciparum gametocytes and protects the parasite from alternative complement pathway-mediated elimination.
See full target information CFH

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com