JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB113594

Recombinant Human FAT10 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FAT10 protein is a Human Full Length protein, in the 1 to 165 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

FAT10, UBD, Ubiquitin D, Diubiquitin, Ubiquitin-like protein FAT10

1 Images
SDS-PAGE - Recombinant Human FAT10 protein (AB113594)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human FAT10 protein (AB113594)

SDS-PAGE of ab113594 (3?g) under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

O15205

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG","proteinLength":"Full Length","predictedMolecularWeight":"20.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":165,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O15205","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FAT10 also known as UBD (Ubiquitin D) is a protein with an approximate mass of 18 kDa. It is a ubiquitin-like modifier involved in post-translational modifications. The protein is expressed in various tissues including the spleen thymus and lymph nodes with elevated levels often detected in cancer cells and tissues responding to proinflammatory cytokines. FAT10 plays a role in signaling for degradation of substrate proteins by the proteasome.
Biological function summary

FAT10 contributes to cellular processes like cell cycle regulation and apoptosis. It forms part of a complex with other ubiquitin-like proteins impacting protein degradation pathways. FAT10's interaction with the proteasome highlights its role in maintaining protein homeostasis and regulating immune response. By tagging proteins for degradation FAT10 influences cellular functions important for adaptation to stress and control of cell proliferation.

Pathways

FAT10 integrates into the NF-kB and TGF-beta pathways. This integration links it to inflammatory responses and tumorigenesis. In the NF-kB pathway FAT10 modulates protein degradation associated with inflammatory signaling and immune regulation. It has connections with other ubiquitin-related proteins such as ubiquitin itself to regulate activities within these pathways impacting cellular responses to external stimuli.

FAT10 shows a significant association with cancer and autoimmune diseases. Its overexpression is noted in various carcinomas including liver and colorectal cancers where it promotes oncogenic pathways and inhibits apoptosis. Additionally in autoimmune conditions such as lupus FAT10's role in regulating immune response becomes pertinent. It often interacts with proteins like p53 in cancer pathologies indicating its involvement in the stabilization and degradation of key regulatory molecules.

Specifications

Form

Liquid

Additional notes

ab113594 was purified using conventional chromatography.

General info

Function

Ubiquitin-like protein modifier which can be covalently attached to target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1-dependent manner. Probably functions as a survival factor. Conjugation ability activated by UBA6. Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. Required for TNF-alpha-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses. Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle. May be involved in the formation of aggresomes when proteasome is saturated or impaired. Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN).

Post-translational modifications

Can be acetylated.

Subcellular localisation

Nucleus

Product protocols

Target data

Ubiquitin-like protein modifier which can be covalently attached to target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1-dependent manner. Probably functions as a survival factor. Conjugation ability activated by UBA6. Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. Required for TNF-alpha-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses. Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle. May be involved in the formation of aggresomes when proteasome is saturated or impaired. Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN).
See full target information UBD Linkage-specific K63

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com