JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB163053

Recombinant Human Fbxw7 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Fbxw7 protein (GST tag N-Terminus) is a Human Fragment protein, in the 599 to 707 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

FBW7, FBX30, SEL10, FBXW7, F-box/WD repeat-containing protein 7, Archipelago homolog, F-box and WD-40 domain-containing protein 7, F-box protein FBX30, SEL-10, hCdc4, hAgo

1 Images
SDS-PAGE - Recombinant Human Fbxw7 protein (GST tag N-Terminus) (AB163053)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Fbxw7 protein (GST tag N-Terminus) (AB163053)

ab163053 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q969H0

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":707,"aminoAcidStart":599,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q969H0","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 17434132, PubMed : 22748924, PubMed : 26976582, PubMed : 28727686, PubMed : 34741373, PubMed : 35395208). Recognizes and binds phosphorylated sites/phosphodegrons within target proteins and thereafter brings them to the SCF complex for ubiquitination (PubMed : 17434132, PubMed : 22748924, PubMed : 26774286, PubMed : 26976582, PubMed : 28727686, PubMed : 34741373). Identified substrates include cyclin-E (CCNE1 or CCNE2), DISC1, JUN, MYC, NOTCH1 released notch intracellular domain (NICD), NFE2L1, NOTCH2, MCL1, MLST8, RICTOR, and probably PSEN1 (PubMed : 11565034, PubMed : 11585921, PubMed : 12354302, PubMed : 14739463, PubMed : 15103331, PubMed : 17558397, PubMed : 17873522, PubMed : 22608923, PubMed : 22748924, PubMed : 25775507, PubMed : 25897075, PubMed : 26976582, PubMed : 28007894, PubMed : 28727686, PubMed : 29149593, PubMed : 34102342). Acts as a negative regulator of JNK signaling by binding to phosphorylated JUN and promoting its ubiquitination and subsequent degradation (PubMed : 14739463). Involved in bone homeostasis and negative regulation of osteoclast differentiation (PubMed : 29149593). Regulates the amplitude of the cyclic expression of hepatic core clock genes and genes involved in lipid and glucose metabolism via ubiquitination and proteasomal degradation of their transcriptional repressor NR1D1; CDK1-dependent phosphorylation of NR1D1 is necessary for SCF(FBXW7)-mediated ubiquitination (PubMed : 27238018). Also able to promote 'Lys-63'-linked ubiquitination in response to DNA damage (PubMed : 26774286). The SCF(FBXW7) complex facilitates double-strand break repair following phosphorylation by ATM : phosphorylation promotes localization to sites of double-strand breaks and 'Lys-63'-linked ubiquitination of phosphorylated XRCC4, enhancing DNA non-homologous end joining (PubMed : 26774286).

Post-translational modifications

Phosphorylation at Thr-205 promotes interaction with PIN1, leading to disrupt FBXW7 dimerization and promoting FBXW7 autoubiquitination and degradation (PubMed:22608923). Phosphorylated by ATM at Ser-26 in response to DNA damage, promoting recruitment to DNA damage sites and 'Lys-63'-linked ubiquitination of phosphorylated XRCC4 (PubMed:26774286).. Ubiquitinated: autoubiquitinates following phosphorylation at Thr-205 and subsequent interaction with PIN1. Ubiquitination leads to its proteasomal degradation (PubMed:22608923).

Subcellular localisation

Nucleus

Product protocols

Target data

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 17434132, PubMed : 22748924, PubMed : 26976582, PubMed : 28727686, PubMed : 34741373, PubMed : 35395208). Recognizes and binds phosphorylated sites/phosphodegrons within target proteins and thereafter brings them to the SCF complex for ubiquitination (PubMed : 17434132, PubMed : 22748924, PubMed : 26774286, PubMed : 26976582, PubMed : 28727686, PubMed : 34741373). Identified substrates include cyclin-E (CCNE1 or CCNE2), DISC1, JUN, MYC, NOTCH1 released notch intracellular domain (NICD), NFE2L1, NOTCH2, MCL1, MLST8, RICTOR, and probably PSEN1 (PubMed : 11565034, PubMed : 11585921, PubMed : 12354302, PubMed : 14739463, PubMed : 15103331, PubMed : 17558397, PubMed : 17873522, PubMed : 22608923, PubMed : 22748924, PubMed : 25775507, PubMed : 25897075, PubMed : 26976582, PubMed : 28007894, PubMed : 28727686, PubMed : 29149593, PubMed : 34102342). Acts as a negative regulator of JNK signaling by binding to phosphorylated JUN and promoting its ubiquitination and subsequent degradation (PubMed : 14739463). Involved in bone homeostasis and negative regulation of osteoclast differentiation (PubMed : 29149593). Regulates the amplitude of the cyclic expression of hepatic core clock genes and genes involved in lipid and glucose metabolism via ubiquitination and proteasomal degradation of their transcriptional repressor NR1D1; CDK1-dependent phosphorylation of NR1D1 is necessary for SCF(FBXW7)-mediated ubiquitination (PubMed : 27238018). Also able to promote 'Lys-63'-linked ubiquitination in response to DNA damage (PubMed : 26774286). The SCF(FBXW7) complex facilitates double-strand break repair following phosphorylation by ATM : phosphorylation promotes localization to sites of double-strand breaks and 'Lys-63'-linked ubiquitination of phosphorylated XRCC4, enhancing DNA non-homologous end joining (PubMed : 26774286).
See full target information FBXW7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com