JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152382

Recombinant Human FCGRT/FCRN protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FCGRT/FCRN protein (GST tag N-Terminus) is a Human Fragment protein, in the 51 to 160 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

FCRN, FCGRT, IgG receptor FcRn large subunit p51, FcRn, IgG Fc fragment receptor transporter alpha chain, Neonatal Fc receptor

1 Images
SDS-PAGE - Recombinant Human FCGRT/FCRN protein (GST tag N-Terminus) (AB152382)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FCGRT/FCRN protein (GST tag N-Terminus) (AB152382)

12.5% SDS-PAGE analysis of ab152382 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P55899

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as FCGRT.

Sequence info

[{"sequence":"GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI","proteinLength":"Fragment","predictedMolecularWeight":"37.84 kDa","actualMolecularWeight":null,"aminoAcidEnd":160,"aminoAcidStart":51,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P55899","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein FCGRT also known as FCRN or FcRn has a significant role in the immune system by binding to the Fc region of immunoglobulin G (IgG). This binding prolongs the half-life of IgG by preventing its lysosomal degradation. The molecular mass of the FCGRT protein is roughly 52 kDa. It is prominently expressed in epithelial and endothelial cells across several tissues including the placenta and liver ensuring IgG stability in circulation.
Biological function summary

FCGRT/FCRN is involved in the transportation and recycling of IgG antibodies. It forms a complex with beta-2 microglobulin that contributes to its function. This complex allows IgG antibodies to traverse cellular barriers such as epithelial cells without being digested. This protein is important in maintaining humoral immunity by regulating IgG levels in the bloodstream and similar processes can be observed in mouse FCRN and cynomolgus monkey milk indicating a conserved mechanism across species.

Pathways

FCGRT/FCRN plays a part in the neonatal Fc receptor pathway. This pathway influences IgG homeostasis and impacts antigen presentation to T cells. By doing so it affects immune surveillance and immune tolerance mechanisms. The pathway involves interactions with related proteins such as albumin which also binds to FCRN for extending its half-life in serum.

Disruptions in FCGRT/FCRN functionality relate to autoimmune conditions and inflammatory diseases. Conditions such as lupus and myasthenia gravis show altered IgG recycling or transportation implicating FCRN in their pathology. Accordingly researchers have explored FCRN inhibitors as potential therapeutic interventions. These inhibitors aim to modulate the interaction between FCRN and IgG therefore impacting the disease progression linked to these disorders.

Specifications

Form

Liquid

General info

Function

Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk (PubMed : 10933786, PubMed : 7964511). IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. Throughout life, contributes to effective humoral immunity by recycling IgG and extending its half-life in the circulation. Mechanistically, monomeric IgG binding to FcRn in acidic endosomes of endothelial and hematopoietic cells recycles IgG to the cell surface where it is released into the circulation (PubMed : 10998088). In addition of IgG, regulates homeostasis of the other most abundant circulating protein albumin/ALB (PubMed : 24469444, PubMed : 28330995).. (Microbial infection) Acts as an uncoating receptor for a panel of echoviruses including Echovirus 5, 6, 7, 9, 11, 13, 25 and 29.

Sequence similarities

Belongs to the immunoglobulin superfamily.

Subcellular localisation

Endosome membrane

Product protocols

Target data

Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk (PubMed : 10933786, PubMed : 7964511). IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. Throughout life, contributes to effective humoral immunity by recycling IgG and extending its half-life in the circulation. Mechanistically, monomeric IgG binding to FcRn in acidic endosomes of endothelial and hematopoietic cells recycles IgG to the cell surface where it is released into the circulation (PubMed : 10998088). In addition of IgG, regulates homeostasis of the other most abundant circulating protein albumin/ALB (PubMed : 24469444, PubMed : 28330995).. (Microbial infection) Acts as an uncoating receptor for a panel of echoviruses including Echovirus 5, 6, 7, 9, 11, 13, 25 and 29.
See full target information FCGRT

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com