JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158424

Recombinant Human FCN1/M-Ficolin protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FCN1/M-Ficolin protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 326 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

FCNM, FCN1, Ficolin-1, Collagen/fibrinogen domain-containing protein 1, Ficolin-A, Ficolin-alpha, M-ficolin

1 Images
SDS-PAGE - Recombinant Human FCN1/M-Ficolin protein (GST tag N-Terminus) (AB158424)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FCN1/M-Ficolin protein (GST tag N-Terminus) (AB158424)

ab158424 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

O00602

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as FCN1.

Sequence info

[{"sequence":"MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":326,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O00602","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FCN1 also known as M-Ficolin or ficolin-1 is a pattern recognition molecule part of the innate immune system. It plays a role in recognizing pathogen-associated molecular patterns (PAMPs) on the surface of microbes. FCN1 is a 35 kDa protein predominantly expressed in the liver and secreted into the bloodstream. It consists of a collagen-like domain and a fibrinogen-like recognition domain allowing it to effectively bind its targets. The protein occurs in plasma where it particularly acts in host defense mechanisms.
Biological function summary

FCN1 functions as part of the body’s first line of immune defense by binding to microbial surfaces facilitating the opsonization and activation of the lectin complement pathway. It is a member of a complex known as the lectin pathway of complement activation which includes MASP1 and MASP2 proteins. FCN1 triggers this pathway when it recognizes patterns such as N-acetylglucosamine on the surface of pathogens which is important for initiating the immune response and promoting pathogen clearance through complement activation in cooperation with other components of the pathway.

Pathways

FCN1 primarily participates in the lectin complement pathway distinctively different from the classical and alternative pathways. It interacts with MASP proteins to trigger the cleavage of complement proteins which leads to a cascade that results in inflammation opsonization and pathogen lysis. FCN1 connections also extend to other pattern recognition receptors such as those in the toll-like receptor pathway which harmonize to ensure a robust immune response by recognizing wide array of pathogen motifs.

FCN1 involvement has been observed in several conditions notably systemic lupus erythematosus (SLE) and bacterial infections. Alterations or deficiencies in FCN1 levels can influence susceptibility to infections due to compromised opsonization and pathogen clearance. In SLE FCN1 and its associated pathway proteins may contribute to the disease pathogenesis by affecting complement system activity leading to autoimmune and inflammatory responses. Understanding these associations aids in unraveling the complex network of immune response regulation and disease development.

Specifications

Form

Liquid

General info

Function

Extracellular lectin, which acts as a pattern recognition receptor that initiates the lectin pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed : 16116205, PubMed : 17897951, PubMed : 20032467). Specifically recognizes and binds carbohydrates on the pathogen surface, activating the MASP1 serine protease and initiating the proteolytic cascade of the lectin complement pathway (PubMed : 16116205, PubMed : 20032467). Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage (PubMed : 20032467, PubMed : 20400674). May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8 (PubMed : 21037097).

Sequence similarities

Belongs to the ficolin lectin family.

Product protocols

Target data

Extracellular lectin, which acts as a pattern recognition receptor that initiates the lectin pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed : 16116205, PubMed : 17897951, PubMed : 20032467). Specifically recognizes and binds carbohydrates on the pathogen surface, activating the MASP1 serine protease and initiating the proteolytic cascade of the lectin complement pathway (PubMed : 16116205, PubMed : 20032467). Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage (PubMed : 20032467, PubMed : 20400674). May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8 (PubMed : 21037097).
See full target information FCN1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com