JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB283482

Recombinant Human FGF 23 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FGF 23 protein (Active) is a Human Full Length protein, in the 25 to 251 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

HYPF, UNQ3027/PRO9828, FGF23, Fibroblast growth factor 23, FGF-23, Phosphatonin, Tumor-derived hypophosphatemia-inducing factor

4 Images
Functional Studies - Recombinant Human FGF 23 protein (Active) (AB283482)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human FGF 23 protein (Active) (AB283482)

Functional analysis of ab283482.

Fully biologically active determined by the dose dependent proliferation of NIH/3T3 cells in the presence of mouse Klotho and heparin. ED50 is ≤7 ng/mL, corresponding to a specific activity of 1.43 x 105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot GR3402007-2

Mass Spectrometry - Recombinant Human FGF 23 protein (Active) (AB283482)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human FGF 23 protein (Active) (AB283482)

Mass determination by ESI-TOF.

Predicted MW is 25389.60 Da (+/- 10 Da by ESI-TOF). Observed MW is 25390.94

HPLC - Recombinant Human FGF 23 protein (Active) (AB283482)
  • HPLC

Supplier Data

HPLC - Recombinant Human FGF 23 protein (Active) (AB283482)

HPLC analysis of ab283482

SDS-PAGE - Recombinant Human FGF 23 protein (Active) (AB283482)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human FGF 23 protein (Active) (AB283482)

SDS-page analysis of ab283482

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, Mass Spec, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent proliferation of NIH/3T3 cells in the presence of mouse Klotho and heparin. ED50 is ≤7 ng/mL, corresponding to a specific activity of 1.43 x 105 units/mg.

Accession

Q9GZV9

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI","proteinLength":"Full Length","predictedMolecularWeight":"25.39 kDa","actualMolecularWeight":"25.39 kDa","aminoAcidEnd":251,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9GZV9","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Fibroblast Growth Factor 23 also known as FGF 23 is a hormone-like protein that plays a role in phosphate and vitamin D metabolism. It is a member of the fibroblast growth factor family and consists of about 251 amino acids with a mass of approximately 32 kDa. FGF 23 is predominantly expressed in bone cells especially osteocytes but it also appears in other tissues such as the thymus and brain. An important tool for quantitative measurement of FGF 23 levels is the FGF 23 ELISA kit which assists in various research and clinical settings.
Biological function summary

FGF 23 plays an important role in regulating phosphate balance in the body. It impacts the function of kidneys by decreasing the reabsorption of phosphate and suppressing the formation of active vitamin D thereby affecting calcium regulation as well. FGF 23 does not operate alone but interacts with co-receptors such as Klotho to activate its receptor complex. The protein functions as part of a larger system that fine-tunes the balance of minerals important for maintaining bone health and metabolic functions.

Pathways

FGF 23 is part of the bone-mineral metabolism axis and is integral to the phosphate regulation pathway. It works closely with proteins like Klotho and FGFR1 and their interaction ensures proper signaling required for maintaining serum phosphate levels. FGF 23 controls vitamin D metabolism by regulating the expression of 1-alpha-hydroxylase and 24-hydroxylase influencing the activity of the related vitamin D endocrine system. Its actions help stabilize phosphate and vitamin D status which are both essential for skeletal and mineral homeostasis.

FGF 23 has a significant connection to conditions such as Hypophosphatemic Rickets and Chronic Kidney Disease (CKD). In these cases FGF 23 levels may become dysregulated leading to abnormal phosphate metabolism and bone mineralization defects. In Hypophosphatemic Rickets altered expression of FGF 23 causes excessive phosphate wasting whereas in CKD increased FGF 23 levels are associated with cardiovascular disease risk and deteriorating kidney function. Klotho as a coreceptor for FGF 23 also influences these pathological conditions highlighting its contribution to phosphate-related disorder mechanisms.

Specifications

Form

Lyophilized

Additional notes

>=95% by SDS-PAGE

General info

Function

Regulator of phosphate homeostasis (PubMed : 11062477). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (PubMed : 11409890). Up-regulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid to decrease PTH secretion (By similarity). Regulator of vitamin-D metabolism (PubMed : 15040831). Negatively regulates osteoblast differentiation and matrix mineralization (PubMed : 18282132).

Sequence similarities

Belongs to the heparin-binding growth factors family.

Post-translational modifications

Following secretion this protein is inactivated by cleavage into a N-terminal fragment and a C-terminal fragment. The processing is effected by proprotein convertases.. O-glycosylated at Thr-171 and Thr-178 by GALNT3 and glycosylation of Thr-178 requires previous glycosylation at Thr171. Glycosylation is necessary for secretion; it blocks processing by proprotein convertases when the O-glycan is alpha 2,6-sialylated. Competition between proprotein convertase cleavage and block of cleavage by O-glycosylation determines the level of secreted active FGF23.. Phosphorylation at Ser-180 mediated by FAM20C slows down glycosylation at Thr-178 notably.

Product protocols

Target data

Regulator of phosphate homeostasis (PubMed : 11062477). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (PubMed : 11409890). Up-regulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid to decrease PTH secretion (By similarity). Regulator of vitamin-D metabolism (PubMed : 15040831). Negatively regulates osteoblast differentiation and matrix mineralization (PubMed : 18282132).
See full target information FGF23

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com