JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB269166

Recombinant human FGF1 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human FGF1 protein (Active) is a Human Full Length protein, in the 16 to 155 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

FGFA, FGF1, Fibroblast growth factor 1, FGF-1, Acidic fibroblast growth factor, Endothelial cell growth factor, Heparin-binding growth factor 1, aFGF, ECGF, HBGF-1

3 Images
Functional Studies - Recombinant human FGF1 protein (Active) (AB269166)
  • FuncS

Unknown

Functional Studies - Recombinant human FGF1 protein (Active) (AB269166)

Biological activity graph of ab269166

Functional Studies - Recombinant human FGF1 protein (Active) (AB269166)
  • FuncS

Unknown

Functional Studies - Recombinant human FGF1 protein (Active) (AB269166)

Biological activity graph of ab269166

SDS-PAGE - Recombinant human FGF1 protein (Active) (AB269166)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human FGF1 protein (Active) (AB269166)

SDS-PAGE analysis of ab269166 at 1ug/lane under (-) non-reducing and (+) reducing conditions. 4-20% Tris glycine gel. Stained with coomassie blue.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

3T3 cell proliferation ≤2 ng/mL; ≥ 5.0 x 10^5 units/mg (typical ED50 is < 1 ng/mL).

Accession

P05230

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute at 0.1 mg/mL in water

Storage buffer

Constituents: Sodium sulphate, 0.16% Sodium phosphate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD","proteinLength":"Full Length","predictedMolecularWeight":"17 kDa","actualMolecularWeight":null,"aminoAcidEnd":155,"aminoAcidStart":16,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P05230","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FGF1 also known as acidic fibroblast growth factor (aFGF) is a member of the fibroblast growth factor family. This protein has a molecular mass of approximately 17 kDa. FGF1 is expressed in a variety of tissues such as the brain liver and heart and plays an essential role in cell growth development and repair. The FGF1 protein is sometimes studied using techniques such as FGF1 ELISA which helps in quantifying and understanding its expression levels and activity in different contexts.
Biological function summary

FGF1 is involved in numerous cellular processes beyond simple cell proliferation. It binds to fibroblast growth factor receptors (FGFRs) on the cell surface initiating a cascade of downstream signaling events. This protein does not act alone; it is often a part of larger protein complexes that modulate cellular processes such as angiogenesis and wound healing. FGF1 is also implicated in nerve cell differentiation and survival through FGFR-mediated pathways.

Pathways

The FGF1 protein is integrally involved in the MAPK/ERK signaling pathway a critical pathway that regulates cell division growth and differentiation. Through this pathway FGF1 interacts with various proteins including Ras Raf and ERK to propagate the signal necessary for mitogenic and survival responses. FGF1 is also a player in the phosphoinositide 3-kinase (PI3K) pathway which helps control cellular responses to stress and metabolic regulation showing its role in cellular homeostasis.

FGF1 is associated with conditions such as cancer and cardiovascular diseases. The deregulation of FGF1 expression or its signaling pathways can lead to tumor development and progression with FGF1 often interacting with other proteins like the basic fibroblast growth factor (bFGF) in these contexts. In cardiovascular diseases altered FGF1 signaling might contribute to atherosclerosis and cardiac repair processes where its interaction with other growth factors like vascular endothelial growth factor (VEGF) is significant.

Specifications

Form

Lyophilized

Additional notes

nan

General info

Function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV : ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed : 18441324, PubMed : 20422052). Can induce angiogenesis (PubMed : 23469107).

Sequence similarities

Belongs to the heparin-binding growth factors family.

Post-translational modifications

In the nucleus, phosphorylated by PKC/PRKCD.

Subcellular localisation

Nucleus

Product protocols

Target data

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV : ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed : 18441324, PubMed : 20422052). Can induce angiogenesis (PubMed : 23469107).
See full target information FGF1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com