JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB9596

Recombinant human FGF2 protein (Active)

5

(2 Reviews)

|

(8 Publications)

Recombinant human FGF2 protein (Active) is a Human Full Length protein in the 135 to 288 aa range with ≥95% purity, < 1 EU/µg endotoxin level and suitable for SDS-PAGE, HPLC and cell culture assays.The predicted molecular weight of ab9596 protein is 17.2 kDa.

- Save time and ensure accurate results - use our recombinant human FGF-2/bFGF/HBGF-2 protein as a control
- Optimal protein bioactivity and stability
- Available in different sizes to fit your experimental needs

View Alternative Names

FGFB, FGF2, Fibroblast growth factor 2, FGF-2, Basic fibroblast growth factor, Heparin-binding growth factor 2, bFGF, HBGF-2

2 Images
Sandwich ELISA - Recombinant human FGF2 protein (Active) (AB9596)
  • sELISA

Unknown

Sandwich ELISA - Recombinant human FGF2 protein (Active) (AB9596)

Standard Curve for FGF basic (Analyte : FGF basic protein (Active) (ab9596)); dilution range 1pg/ml to 1ug/ml using Capture Antibody Mouse monoclonal [AS24] to FGF basic (ab17279) at 1ug/ml and Detector Antibody Rabbit monoclonal [EP1735] to FGF basic (ab92337) at 0.5ug/ml.

Cell Differentiation - Recombinant human FGF2 protein (Active) (AB9596)
  • CellDiff

Unknown

Cell Differentiation - Recombinant human FGF2 protein (Active) (AB9596)

Human embryonic stem cells (H9) were differentiated both as embryoid bodies and monolayer cultures (on Matrigel) using a protocol described in Kennedy et al., 2007. BMP-4, FGF-basic (ab9596) and VEGF (ab9571) were sequentially added to the media to direct differentiation. These images were taken at day 8, where cell adhesion antigens CD31 (ab32457 in green) and CD34 (ab8536 in red) are abundant and represent primitive haematopoietic cells within the culture. Dapi staining is shown in blue.

This image is courtesy of Sun Yung, Centro de Investigación Príncipe Felipe.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

CellAct, CellDiff, HPLC, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Determined by a cell proliferation assay using Balb/c 3T3 cells.

The expected ED50 is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg.

Accession

P09038

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute in 5 mM Tris, pH 7.6

Storage buffer

Constituents: 0.87% Sodium chloride, 0.0605% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "CellDiff": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "CellAct": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our bioactive recombinant human FGF-2/bFGF/HBGF-2 protein ab9596 as a control in SDS-PAGE and HPLC.

Can be used in cell culture assays for stem cell use.


Check out our protein gel staining guide for SDS-PAGE here

Sequence info

[{"sequence":"AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS","proteinLength":"Full Length","predictedMolecularWeight":"17.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":288,"aminoAcidStart":135,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P09038","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FGF2 also known as FGF-2 or basic fibroblast growth factor is a protein that plays important roles in various cellular processes. It is a member of the fibroblast growth factor family and has a molecular weight of approximately 18 kDa. Scientists find FGF2 protein in many tissues including brain myocardium and bone. The protein can exist in different forms including recombinant variants. It interacts with cell surface receptors to exert its effects significantly influencing cell behavior.
Biological function summary

Various functions characterize FGF2 such as cell proliferation differentiation and migration. It does not act alone but is part of a larger protein complex. This complex includes FGF receptors which help mediate the binding of the FGF2 peptide ensuring proper signaling within the cells. FGF2 is important for development and repair processes making it an essential factor in tissue maintenance and regeneration.

Pathways

FGF2 plays a big role in critical pathways like the MAPK/ERK signaling pathway and PI3K/Akt pathway. These pathways help regulate the processes of cell growth and survival. FGF2 interacts with other protein molecules such as FGFR1 and FGFR2 which serve as receptors to propagate the signaling cascade initiated by FGF2 binding. Its interaction in these pathways underlines its role in modulating important cellular responses.

Scientists connect FGF2 with conditions such as cancer and atherosclerosis. The protein's deregulation may lead to abnormal cell proliferation contributing to tumor growth and vascular diseases. FGF2's interaction with proteins like FGFR1 can influence cancer progression and plaque formation in blood vessels. By understanding FGF2's role in these diseases researchers aim to develop targeted therapies that can potentially alter disease outcomes.

Specifications

Form

Lyophilized

Additional notes

>= 95% HPLCSterile filtered

General info

Function

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed : 8663044). Also acts as an integrin ligand which is required for FGF2 signaling (PubMed : 28302677). Binds to integrin ITGAV : ITGB3 (PubMed : 28302677). Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration (PubMed : 28302677, PubMed : 8663044). Functions as a potent mitogen in vitro (PubMed : 1721615, PubMed : 3732516, PubMed : 3964259). Can induce angiogenesis (PubMed : 23469107, PubMed : 28302677). Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation (PubMed : 29501879).

Sequence similarities

Belongs to the heparin-binding growth factors family.

Post-translational modifications

Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.. Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.

Product protocols

Target data

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (PubMed : 8663044). Also acts as an integrin ligand which is required for FGF2 signaling (PubMed : 28302677). Binds to integrin ITGAV : ITGB3 (PubMed : 28302677). Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration (PubMed : 28302677, PubMed : 8663044). Functions as a potent mitogen in vitro (PubMed : 1721615, PubMed : 3732516, PubMed : 3964259). Can induce angiogenesis (PubMed : 23469107, PubMed : 28302677). Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation (PubMed : 29501879).
See full target information FGF2

Publications (8)

Recent publications for all applications. Explore the full list and refine your search

European journal of dentistry 19:729-734 PubMed39657939

2024

Improvement of Dentin Growth Parameters (Beta-catenin, bFGF, CD105, and BMP4) with Propolis as Adjuvant in Dental Caries Treatment.

Applications

Unspecified application

Species

Unspecified reactive species

Retno Pudji Rahayu,Nirawati Pribadi,Ira Widjiastuti,Nur Ariska Nugrahani

Stem cell research & therapy 15:364 PubMed39402677

2024

iPSC-derived megakaryocytes and platelets accelerate wound healing and angiogenesis.

Applications

Unspecified application

Species

Unspecified reactive species

Kentaro Kosaka,Naoya Takayama,Sudip Kumar Paul,Maria Alejandra Kanashiro,Motohiko Oshima,Masaki Fukuyo,Bahityar Rahmutulla,Ikuko Tajiri,Michiaki Mukai,Yoshitaka Kubota,Shinsuke Akita,Nobutaka Furuyama,Atsushi Kaneda,Atsushi Iwama,Koji Eto,Nobuyuki Mitsukawa

Biomedicines 12: PubMed39335635

2024

Exploring the Antibacterial and Regenerative Properties of a Two-Stage Alginate Wound Dressing in a Rat Model of Purulent Wounds.

Applications

Unspecified application

Species

Unspecified reactive species

Aliya Atepileva,Vyacheslav Ogay,Gulshahar Kudaibergen,Guldarigash Kaukabaeva,Assiya Nurkina,Ainur Mukhambetova,Serik Balgazarov,Arman Batpen,Dina Saginova,Zhanatay Ramazanov,Amanzhol Balgazarov,Zhanar Akhmetkarimova

The EMBO journal 43:2127-2165 PubMed38580776

2024

Limited oxygen in standard cell culture alters metabolism and function of differentiated cells.

Applications

Unspecified application

Species

Unspecified reactive species

Joycelyn Tan,Sam Virtue,Dougall M Norris,Olivia J Conway,Ming Yang,Guillaume Bidault,Christopher Gribben,Fatima Lugtu,Ioannis Kamzolas,James R Krycer,Richard J Mills,Lu Liang,Conceição Pereira,Martin Dale,Amber S Shun-Shion,Harry Jm Baird,James A Horscroft,Alice P Sowton,Marcella Ma,Stefania Carobbio,Evangelia Petsalaki,Andrew J Murray,David C Gershlick,James A Nathan,James E Hudson,Ludovic Vallier,Kelsey H Fisher-Wellman,Christian Frezza,Antonio Vidal-Puig,Daniel J Fazakerley

Communications biology 5:1349 PubMed36482075

2022

Controlled release of growth factors using synthetic glycosaminoglycans in a modular macroporous scaffold for tissue regeneration.

Applications

Unspecified application

Species

Unspecified reactive species

Z Söderlund,A Ibáñez-Fonseca,S Hajizadeh,J C Rodríguez-Cabello,J Liu,L Ye,E Tykesson,L Elowsson,G Westergren-Thorsson

Frontiers in pharmacology 13:905082 PubMed36034873

2022

Posaconazole inhibits the stemness of cancer stem-like cells by inducing autophagy and suppressing the Wnt/β-catenin/survivin signaling pathway in glioblastoma.

Applications

Unspecified application

Species

Unspecified reactive species

Hua Wang,Yinfeng Tan,Hao Jia,Danqi Liu,Rangru Liu

Experimental and molecular pathology 118:104590 PubMed33285208

2020

Effect of fibroblast growth factor 2 on degenerative endplate chondrocyte: From anabolism to catabolism.

Applications

Unspecified application

Species

Unspecified reactive species

Hua Song,Hongyang Du,Jie Li,Mingming Wang,Jianhua Wang,Xuezhuang Ju,Weidong Mu

Molecular oncology 13:290-306 PubMed30422399

2018

Fibroblast Growth Factor 2 lethally sensitizes cancer cells to stress-targeted therapeutic inhibitors.

Applications

Unspecified application

Species

Unspecified reactive species

Matheus H Dias,Cecília S Fonseca,Julianna D Zeidler,Layra L Albuquerque,Marcelo S da Silva,Eduardo Cararo-Lopes,Marcelo S Reis,Vincent Noël,Edmilson O Dos Santos,Ian A Prior,Hugo A Armelin
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com