JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB201397

Recombinant human FGFR1OP-FGFR1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human FGFR1OP-FGFR1 protein is a Human Fragment protein, in the 429 to 822 aa range, expressed in Baculovirus infected Sf9 cells, with >70%, suitable for SDS-PAGE, FuncS.

View Alternative Names

CD331, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR, FGFR1, Fibroblast growth factor receptor 1, FGFR-1, Basic fibroblast growth factor receptor 1, Fms-like tyrosine kinase 2, N-sam, Proto-oncogene c-Fgr, bFGF-R-1, FLT-2

4 Images
Functional Studies - Recombinant human FGFR1OP-FGFR1 protein (AB201397)
  • FuncS

Unknown

Functional Studies - Recombinant human FGFR1OP-FGFR1 protein (AB201397)

The specific activity of FGFR1OP-FGFR1 (ab201397) was determined to be 80 nmol/min/mg as per activity assay protocol and was equivalent to 400 nmol/min/mg as per radiometric assay

Functional Studies - Recombinant human FGFR1OP-FGFR1 protein (AB201397)
  • FuncS

Supplier Data

Functional Studies - Recombinant human FGFR1OP-FGFR1 protein (AB201397)

Sample Kinase assay using ab201397.

SDS-PAGE - Recombinant human FGFR1OP-FGFR1 protein (AB201397)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human FGFR1OP-FGFR1 protein (AB201397)

SDS PAGE analysis of ab201397

SDS-PAGE - Recombinant human FGFR1OP-FGFR1 protein (AB201397)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human FGFR1OP-FGFR1 protein (AB201397)

SDS PAGE analysis of ab201397

Key facts

Purity

>70% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific activity of ab201397 determined by kinase assay was found to be 350 nmol/ min/ mg

Accession

P11362

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.003% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% EDTA, 0.001% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"VSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":822,"aminoAcidStart":429,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P11362","tags":[]},{"sequence":"MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSK","proteinLength":"Fragment","predictedMolecularWeight":"108 kDa","actualMolecularWeight":null,"aminoAcidEnd":173,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P11362","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The FGFR1OP-FGFR1 is a fusion protein resulting from the translocation between the FGFR1 oncogene and the FGFR1OP gene. This fusion is noteworthy in its mechanical role as it forms a constitutively active tyrosine kinase. The FGFR1OP-FGFR1 protein has a molecular mass that varies depending on the fusion breakpoint generally ranging from 100 to 120 kDa. Expressed predominantly in certain hematopoietic cells this fusion oncoprotein continually sends proliferative signals which alter normal cellular functions.
Biological function summary

FGFR1OP-FGFR1 fusion plays a significant role in driving abnormal cell growth and survival. The fusion protein is an active component within larger protein complexes that facilitate aberrant signaling. By bypassing typical regulatory mechanisms FGFR1OP-FGFR1 fusion protein leads to unchecked cellular division. In addition to maintaining survival pathways it disrupts normal differentiation processes in affected cells.

Pathways

FGFR1OP-FGFR1 is heavily implicated in the MAPK and PI3K/AKT signaling pathways which are central to cell cycle progression and survival. Key proteins related to these pathways include RAS RAF and AKT proteins which interact to propagate oncogenic signals downstream of the FGFR1OP-FGFR1 fusion. These interactions lead to heightened proliferative responses and resistance to apoptosis steering cells towards oncogenesis.

FGFR1OP-FGFR1 fusion is mostly connected to hematological malignancies mainly myeloproliferative neoplasms such as 8p11 myeloproliferative syndrome. Myelodysplastic syndromes have also shown associations with this protein. The FGFR1OP-FGFR1 fusion protein interacts closely with other oncoproteins like BCR-ABL enhancing its leukemogenic potential. Understanding and targeting this fusion protein is critical for effective therapies for these disorders.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.

Post-translational modifications

Autophosphorylated. Binding of FGF family members together with heparan sulfate proteoglycan or heparin promotes receptor dimerization and autophosphorylation on tyrosine residues. Autophosphorylation occurs in trans between the two FGFR molecules present in the dimer and proceeds in a highly ordered manner. Initial autophosphorylation at Tyr-653 increases the kinase activity by a factor of 50 to 100. After this, Tyr-583 becomes phosphorylated, followed by phosphorylation of Tyr-463, Tyr-766, Tyr-583 and Tyr-585. In a third stage, Tyr-654 is autophosphorylated, resulting in a further tenfold increase of kinase activity. Phosphotyrosine residues provide docking sites for interacting proteins and so are crucial for FGFR1 function and its regulation.. Ubiquitinated. FGFR1 is rapidly ubiquitinated by NEDD4 after autophosphorylation, leading to internalization and lysosomal degradation. CBL is recruited to activated FGFR1 via FRS2 and GRB2, and mediates ubiquitination and subsequent degradation of FGFR1.. N-glycosylated in the endoplasmic reticulum. The N-glycan chains undergo further maturation to an Endo H-resistant form in the Golgi apparatus.

Subcellular localisation

Nucleus

Product protocols

Target data

Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. Required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Phosphorylates PLCG1, FRS2, GAB1 and SHB. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes phosphorylation of SHC1, STAT1 and PTPN11/SHP2. In the nucleus, enhances RPS6KA1 and CREB1 activity and contributes to the regulation of transcription. FGFR1 signaling is down-regulated by IL17RD/SEF, and by FGFR1 ubiquitination, internalization and degradation.
See full target information FGFR1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com