JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB290073

Recombinant Human FGFR3 Protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FGFR3 Protein (Active) is a Human Fragment protein, in the 23 to 375 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

CD333, JTK4, FGFR3, Fibroblast growth factor receptor 3, FGFR-3

4 Images
Functional Studies - Recombinant Human FGFR3 Protein (Active) (AB290073)
  • FuncS

Supplier Data

Functional Studies - Recombinant Human FGFR3 Protein (Active) (AB290073)

Fully biologically active determined by the ability to inhibit FGF1 dependent proliferation of Balb/c-3T3. ED50 is ≤ 2.3 μg/ml, corresponding to a specific activity of 4.35x10² units/mg.  Cell based assay testing is performed on the first lot of the protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot. Lot GR3447559-1.

Mass Spectrometry - Recombinant Human FGFR3 Protein (Active) (AB290073)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human FGFR3 Protein (Active) (AB290073)

Mass determination by ESI-TOF.

Predicted MW is 38199.55 Da. (+/- 10 Da by ESI-TOF). Observed MW is 38205.71 Da.

SDS-PAGE - Recombinant Human FGFR3 Protein (Active) (AB290073)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human FGFR3 Protein (Active) (AB290073)

SDS-PAGE analysis of ab290073

HPLC - Recombinant Human FGFR3 Protein (Active) (AB290073)
  • HPLC

Supplier Data

HPLC - Recombinant Human FGFR3 Protein (Active) (AB290073)

HPLC analysis of ab290073

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, HPLC, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the ability to inhibit FGF1 dependent proliferation of Balb/c-3T3.

ED50 is ≤ 2.3 μg/ml, corresponding to a specific activity of 4.35x102 units/mg.

Accession

P22607

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":375,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P22607","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FGFR3 or fibroblast growth factor receptor 3 is a tyrosine kinase receptor with a molecular mass of approximately 95 kDa. This receptor also known as CD333 primarily interacts with fibroblast growth factors. It resides on the cell surface and is predominately expressed in bone cartilage and the brain. FGFR3 plays a major role in cell growth regulation and differentiation affecting how cells respond to external signals.
Biological function summary

FGFR3 participates in important processes such as chondrogenesis and osteogenesis which are essential for bone growth and development. The receptor operates within a complex system involving interactions with ligand-induced dimerization and autophosphorylation. This phosphorylation event activates the receptor's intrinsic kinase activity further triggering downstream signaling pathways for cellular responses.

Pathways

FGFR3 is involved with the MAPK/ERK and PI3K/AKT pathways which play significant roles in cell proliferation differentiation and survival. FGFR3 links closely with FGF ligands and similar receptor types such as FGFR1 and FGFR2 within these pathways. Differences in pathway activation can lead to diverse biological responses illustrating its pivotal role in maintaining cellular homeostasis.

FGFR3 mutations have significant links to skeletal disorders most notably achondroplasia characterized by short limbs and abnormal bone growth. FGFR3 also associates with bladder cancer where overactivity of the receptor leads to increased cell proliferation and survival. Mutations in FGFR3 often correlate with these conditions impacting signaling pathways and interacting with proteins such as PTPN11 highlighting its critical role in pathogenesis.

Specifications

Form

Lyophilized

General info

Function

Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis. Plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promote cancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Plays a role in the regulation of vitamin D metabolism. Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation, internalization and degradation lead to aberrant signaling. Over-expressed or constitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A and STAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence may interfere with FGF signaling.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Fibroblast growth factor receptor subfamily.

Post-translational modifications

Autophosphorylated. Binding of FGF family members together with heparan sulfate proteoglycan or heparin promotes receptor dimerization and autophosphorylation on tyrosine residues. Autophosphorylation occurs in trans between the two FGFR molecules present in the dimer. Phosphorylation at Tyr-724 is essential for stimulation of cell proliferation and activation of PIK3R1, STAT1 and MAP kinase signaling. Phosphorylation at Tyr-760 is required for interaction with PIK3R1 and PLCG1.. Ubiquitinated. Is rapidly ubiquitinated after ligand binding and autophosphorylation, leading to receptor internalization and degradation. Subject to both proteasomal and lysosomal degradation.. N-glycosylated in the endoplasmic reticulum. The N-glycan chains undergo further maturation to an Endo H-resistant form in the Golgi apparatus.

Product protocols

Target data

Tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and plays an essential role in the regulation of cell proliferation, differentiation and apoptosis. Plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. Regulates both osteogenesis and postnatal bone mineralization by osteoblasts. Promotes apoptosis in chondrocytes, but can also promote cancer cell proliferation. Required for normal development of the inner ear. Phosphorylates PLCG1, CBL and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Plays a role in the regulation of vitamin D metabolism. Mutations that lead to constitutive kinase activation or impair normal FGFR3 maturation, internalization and degradation lead to aberrant signaling. Over-expressed or constitutively activated FGFR3 promotes activation of PTPN11/SHP2, STAT1, STAT5A and STAT5B. Secreted isoform 3 retains its capacity to bind FGF1 and FGF2 and hence may interfere with FGF signaling.
See full target information FGFR3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com