JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB95856

Recombinant Human FHIT protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FHIT protein (His tag C-Terminus) is a Human Full Length protein, in the 1 to 147 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Bis(5'-adenosyl)-triphosphatase, AP3A hydrolase, Adenosine 5'-monophosphoramidase FHIT, Adenylylsulfatase, Adenylylsulfate-ammonia adenylyltransferase, Dinucleosidetriphosphatase, Fragile histidine triad protein, AP3Aase, FHIT

1 Images
SDS-PAGE - Recombinant Human FHIT protein (His tag C-Terminus) (AB95856)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human FHIT protein (His tag C-Terminus) (AB95856)

15% SDS-PAGE showing ab95856 at approximately 17.9kDa (3µg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P49789

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQLEHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"17.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":147,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P49789","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The 'FHIT' protein also known as the Fragile Histidine Triad protein weighs about 16.8 kDa. It is a tumor suppressor and is widely expressed in various tissues including the lungs kidneys and pancreas. FHIT is encoded by the FHIT gene located on chromosome 3 specifically at a common fragile site. The protein plays an important role in maintaining genomic integrity and preventing tumorigenesis. It acts as a diadenosine triphosphate hydrolase breaking down dinucleoside polyphosphates.
Biological function summary

The FHIT protein interacts with other cellular proteins to regulate apoptosis and cell proliferation. It is part of several molecular complexes that are involved in cellular stress responses. The FHIT protein binds to other proteins to initiate a cascade of events leading to programmed cell death in cells with damaged DNA. This role is critical because it prevents the development of cancer by eliminating potentially malignant cells before they proliferate.

Pathways

The FHIT protein participates in the DNA damage response and apoptotic pathways. It is related to the p53 signaling pathway a major pathway controlling cell cycle arrest and apoptosis. FHIT is thought to modulate p53 activity promoting apoptosis in response to genotoxic stress. It also synergizes with proteins like PTEN to enhance protective responses against DNA damage helping to regulate cell survival and proliferation.

The FHIT protein has significant implications for cancer particularly lung and esophageal cancers. Studies show that loss of FHIT expression correlates with tumor progression and a poor prognosis in these cancers. The protein's inactivation often pairs with mutations in proteins like p53 which further disrupts cell cycle control and enhances malignant transformation. FHIT serves as a marker for early detection and a potential target for therapeutic intervention.

Specifications

Form

Liquid

Additional notes

ab95856 is purified using conventional chromatography techniques.

General info

Function

Possesses dinucleoside triphosphate hydrolase activity (PubMed : 12574506, PubMed : 15182206, PubMed : 8794732, PubMed : 9323207, PubMed : 9543008, PubMed : 9576908). Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP (PubMed : 12574506, PubMed : 15182206, PubMed : 8794732, PubMed : 9323207, PubMed : 9543008, PubMed : 9576908). Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP (PubMed : 8794732). Exhibits adenylylsulfatase activity, hydrolyzing adenosine 5'-phosphosulfate to yield AMP and sulfate (PubMed : 18694747). Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (PubMed : 18694747). Exhibits adenylylsulfate-ammonia adenylyltransferase, catalyzing the ammonolysis of adenosine 5'-phosphosulfate resulting in the formation of adenosine 5'-phosphoramidate (PubMed : 26181368). Also catalyzes the ammonolysis of adenosine 5-phosphorofluoridate and diadenosine triphosphate (PubMed : 26181368). Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5 (PubMed : 18077326). Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways (PubMed : 16407838). Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis (PubMed : 15313915). Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity, it may in part come from the mitochondrial form, which sensitizes the low-affinity Ca(2+) transporters, enhancing mitochondrial calcium uptake (PubMed : 12574506, PubMed : 19622739). Functions as a tumor suppressor (By similarity).

Post-translational modifications

Phosphorylation at Tyr-114 by SRC is required for induction of apoptosis.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Possesses dinucleoside triphosphate hydrolase activity (PubMed : 12574506, PubMed : 15182206, PubMed : 8794732, PubMed : 9323207, PubMed : 9543008, PubMed : 9576908). Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP (PubMed : 12574506, PubMed : 15182206, PubMed : 8794732, PubMed : 9323207, PubMed : 9543008, PubMed : 9576908). Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP (PubMed : 8794732). Exhibits adenylylsulfatase activity, hydrolyzing adenosine 5'-phosphosulfate to yield AMP and sulfate (PubMed : 18694747). Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (PubMed : 18694747). Exhibits adenylylsulfate-ammonia adenylyltransferase, catalyzing the ammonolysis of adenosine 5'-phosphosulfate resulting in the formation of adenosine 5'-phosphoramidate (PubMed : 26181368). Also catalyzes the ammonolysis of adenosine 5-phosphorofluoridate and diadenosine triphosphate (PubMed : 26181368). Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5 (PubMed : 18077326). Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways (PubMed : 16407838). Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis (PubMed : 15313915). Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity, it may in part come from the mitochondrial form, which sensitizes the low-affinity Ca(2+) transporters, enhancing mitochondrial calcium uptake (PubMed : 12574506, PubMed : 19622739). Functions as a tumor suppressor (By similarity).
See full target information Bis(5'-adenosyl)-triphosphatase

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com