JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB206440

Recombinant Human FKBP51 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FKBP51 protein (His tag) is a Human Full Length protein, in the 1 to 457 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

AIG6, FKBP51, FKBP5, Peptidyl-prolyl cis-trans isomerase FKBP5, PPIase FKBP5, 51 kDa FK506-binding protein, 54 kDa progesterone receptor-associated immunophilin, Androgen-regulated protein 6, FF1 antigen, FK506-binding protein 5, FKBP54, HSP90-binding immunophilin, Rotamase, 51 kDa FKBP, FKBP-51, FKBP-5, p54

1 Images
SDS-PAGE - Recombinant Human FKBP51 protein (His tag) (AB206440)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human FKBP51 protein (His tag) (AB206440)

12 % SDS-PAGE separation of Human FKBP5.

MW Marker : 14, 21, 31, 45, 66, 97 kDa

Lane 1 : Reduced and boiled sample, 2.5 μg/lane

Lane 2 : Non-reduced and non-boiled sample, 2.5 μg/lane

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q13451

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Storage buffer

Constituents: 0.32% Tris buffer, 0.29% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MKHHHHHHASMTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV","proteinLength":"Full Length","predictedMolecularWeight":"52.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":457,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13451","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FKBP51 also known as FKBP5 is an immunophilin protein with a molecular mass around 51 kDa. It functions as a peptidyl-prolyl isomerase that assists protein folding by catalyzing the cis-trans isomerization of prolyl bonds. FKBP51 is expressed in various tissues including the brain liver kidney and skeletal muscle. The protein serves multiple mechanical roles including the modulation of protein receptor complexes and interaction with other molecular chaperones.
Biological function summary

FKBP51 plays a role in cellular stress responses and steroid receptor signaling. It is part of large complexes such as the glucocorticoid receptor complex where it modulates receptor sensitivity and translocation to the nucleus. FKBP51 influences the stress hormone pathway by affecting the receptor's binding affinity and contributing to the regulation of inflammatory responses. By playing a regulatory role in hormonal signaling FKBP51 impacts several biological processes including development and metabolism.

Pathways

FKBP51 interacts with the hypothalamus-pituitary-adrenal (HPA) axis and the AKT/mTOR signaling pathway. It interacts with proteins like Hsp90 and PHLPP impacting stress response and cellular growth regulation. The modulation of these pathways affects stress-related behaviors and cellular homeostasis. FKBP51's interaction with the HPA axis plays a significant role in stress response regulation making it an essential component of the body's adaptation mechanisms.

FKBP51 has strong associations with mood disorders and cancer. Its upregulation correlates with stress-related psychiatric conditions such as depression impacting the function of other stress-related proteins like glucocorticoid receptors. In cancer FKBP51 modulates tumor growth and survival pathways interacting with proteins involved in cell proliferation and death such as the AKT protein. Understanding FKBP51's role in these conditions helps identify potential therapeutic targets for treatment.

Specifications

Form

Lyophilized

General info

Function

Immunophilin protein with PPIase and co-chaperone activities (PubMed : 11350175). Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). Plays a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors maintaining the complex into the cytoplasm when unliganded (PubMed : 12538866). Acts as a regulator of Akt/AKT1 activity by promoting the interaction between Akt/AKT1 and PHLPP1, thereby enhancing dephosphorylation and subsequent activation of Akt/AKT1 (PubMed : 28147277, PubMed : 28363942). Interacts with IKBKE and IKBKB which facilitates IKK complex assembly leading to increased IKBKE and IKBKB kinase activity, NF-kappa-B activation, and IFN production (PubMed : 26101251, PubMed : 31434731).

Post-translational modifications

Acetylation impairs ability to promote interaction between Akt/AKT1 and PHLPP1 (PubMed:28147277). Deacetylation by SIRT7 promotes interaction between Akt/AKT1 and PHLPP1, leading to suppress Akt/AKT1 activation (PubMed:28147277).. Ubiquitinated, leading to degradation in a proteasome-dependent manner. Deubiquitinated by USP49, leading to stabilization.

Subcellular localisation

Nucleus

Product protocols

Target data

Immunophilin protein with PPIase and co-chaperone activities (PubMed : 11350175). Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). Plays a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors maintaining the complex into the cytoplasm when unliganded (PubMed : 12538866). Acts as a regulator of Akt/AKT1 activity by promoting the interaction between Akt/AKT1 and PHLPP1, thereby enhancing dephosphorylation and subsequent activation of Akt/AKT1 (PubMed : 28147277, PubMed : 28363942). Interacts with IKBKE and IKBKB which facilitates IKK complex assembly leading to increased IKBKE and IKBKB kinase activity, NF-kappa-B activation, and IFN production (PubMed : 26101251, PubMed : 31434731).
See full target information FKBP5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com