JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB282388

Recombinant human Flt3 ligand/Flt3L protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Flt3 ligand/Flt3L protein (Active) is a Human Fragment protein, in the 27 to 184 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC, Cell Culture.

View Alternative Names

Fms-related tyrosine kinase 3 ligand, Flt3 ligand, Flt3L, SL cytokine, FLT3LG

4 Images
Mass Spectrometry - Recombinant human Flt3 ligand/Flt3L protein (Active) (AB282388)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human Flt3 ligand/Flt3L protein (Active) (AB282388)

Mass determination by ESI-TOF.

Predicted MW is 18010.63 Da. (+/- 10 Da by ESI-TOF). Observed MW is 18011.42 Da. Significant heterogeneity in the protein due to multiple glycoforms.

Functional Studies - Recombinant human Flt3 ligand/Flt3L protein (Active) (AB282388)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Flt3 ligand/Flt3L protein (Active) (AB282388)

Functional analysis of ab282388.

Fully biologically active determined by dose dependent proliferation of AML-5 cells.

ED50 for this effect is ≤1.058 ng/ml, corresponding to a specific activity of 9.45 x 105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3391959-1

SDS-PAGE - Recombinant human Flt3 ligand/Flt3L protein (Active) (AB282388)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Flt3 ligand/Flt3L protein (Active) (AB282388)

SDS-PAGE analysis of ab282388.

HPLC - Recombinant human Flt3 ligand/Flt3L protein (Active) (AB282388)
  • HPLC

Supplier Data

HPLC - Recombinant human Flt3 ligand/Flt3L protein (Active) (AB282388)

HPLC analysis of ab282388.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, HPLC, Cell Culture, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by dose dependent proliferation of AML-5 cells.

ED50 for this effect is ≤1.058 ng/ml, corresponding to a specific activity of 9.45 x 105 units/mg.

Accession

P49771

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.428% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Cell Culture": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

For research use only and are not intended for diagnositc or therapeutic use, not for use in humans.

Sequence info

[{"sequence":"TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP","proteinLength":"Fragment","predictedMolecularWeight":"18.01 kDa","actualMolecularWeight":"18.01 kDa","aminoAcidEnd":184,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P49771","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Flt3 ligand (Flt3L) also known as Flt3-L Flt3 ligand protein or flt-3 ligand protein is a small cytokine with a molecular mass of approximately 18 to 19 kDa. It acts as a growth factor by binding to the Flt3 receptor tyrosine kinase on the surface of hematopoietic progenitor cells. Flt3L is expressed in various tissues including the bone marrow where it plays a significant role in hematopoiesis. It is critical in dendritic cell and B cell development impacting the immune response mechanism.
Biological function summary

The Flt3 ligand plays an essential role in the immune system. It is a monomeric cytokine that induces proliferation of early lineage cells within the hematopoietic system. Flt3L does not function as part of a complex but acts independently to stimulate the proliferation differentiation and survival of hematopoietic cells. By interacting directly with its receptor it significantly influences the innate and adaptive immune systems through the maturation of dendritic and B cells.

Pathways

The Flt3 ligand is involved in hematopoietic signaling pathways primarily the PI3K-Akt signaling pathway. This pathway is essential for cell survival and growth where Flt3L aids in transmitting growth signals necessary for hematopoietic cells. Flt3L also interacts with proteins such as FLT3 receptor and influences the downstream signaling cascade affecting cell fate decisions in hematopoiesis and immune cell maturation.

Flt3 ligand is connected to leukemia particularly acute myeloid leukemia (AML) due to dysregulation of the FLT3 signaling pathway. Mutations in the FLT3 receptor can lead to uncontrolled cell proliferation contributing to tumorigenesis. Additionally Flt3L plays a role in autoimmune disorders by influencing immune cell development. It is closely connected with the FLT3 receptor and other tyrosine kinases which when mutated can exacerbate disease pathology through abnormal cell signaling and proliferation.

Specifications

Form

Lyophilized

Additional notes

>=95% purity by HPLC.

General info

Function

Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.

Product protocols

Target data

Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
See full target information FLT3LG

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com