JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132166

Recombinant Human FOXP1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FOXP1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 114 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

HSPC215, FOXP1, Forkhead box protein P1, Mac-1-regulated forkhead, MFH

1 Images
SDS-PAGE - Recombinant Human FOXP1 protein (GST tag N-Terminus) (AB132166)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FOXP1 protein (GST tag N-Terminus) (AB132166)

12.5% SDS-PAGE analysis of ab132166 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q9H334

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF","proteinLength":"Full Length","predictedMolecularWeight":"38.28 kDa","actualMolecularWeight":null,"aminoAcidEnd":114,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9H334","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FOXP1 also known as forkhead box P1 is a transcription factor that belongs to the forkhead box (FOX) family. This protein weighs approximately 75-80 kDa and is expressed in a variety of tissues including the brain heart and lung. It plays a role in regulating gene expression acting as a transcriptional repressor or activator depending on the context. FOXP1 modulates several developmental processes through its interaction with DNA influencing cellular differentiation and proliferation. Its activity is vital in embryonic development and in maintaining the function of certain adult tissues.
Biological function summary

This transcription factor functions in the regulation of gene expression associated with neurodevelopment cardiac growth and immune responses. FOXP1 often forms a complex with other transcription factors such as FOXP2 and FOXP4 which enhances its regulatory roles. These interactions allow it to control various genetic programs that are important in the maturation and specification of different cell types. Moreover FOXP1 contributes to the modulation of B-cell development and function highlighting its importance in immune system regulation.

Pathways

FOXP1 takes part in several key signaling pathways including the Wnt signaling pathway and the TGF-beta pathway. The Wnt signaling pathway relates FOXP1 to β-catenin influencing the expression of genes involved in cell proliferation and differentiation. In the TGF-beta pathway its interactions with SMAD proteins underline its function in cellular processes such as apoptosis and epithelial–mesenchymal transition. These pathways emphasize FOXP1's contribution to controlling cell growth and development across different biological contexts.

Disruptions in the function of this transcription factor have been linked to conditions like intellectual disability and certain types of cancer including lymphoma. The relationship between FOXP1 and proteins such as BCL2 in lymphoma highlights its role in tumorigenesis and progression. Additionally mutations affecting FOXP1 can disturb its interaction with other forkhead family proteins leading to neurodevelopmental disorders that impact cognitive abilities and behavior. Understanding these connections provides insights into how FOXP1's altered activity can contribute to disease pathology.

Specifications

Form

Liquid

General info

Function

Transcriptional repressor (PubMed : 18347093, PubMed : 26647308). Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential (By similarity). Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal cord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in embryonic stem cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintenance of hair follicle stem cell quiescence; the function probably involves regulation of FGF18 (By similarity). Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis (PubMed : 25267198). Binds to CSF1R promoter elements and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes seems to involve NCOR2 as corepressor (PubMed : 15286807, PubMed : 18347093, PubMed : 18799727). Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization seems to implicate suppression of SEMA5B (PubMed : 24023716). Can negatively regulate androgen receptor signaling (PubMed : 18640093). Acts as a transcriptional activator of the FBXL7 promoter; this activity is regulated by AURKA (PubMed : 28218735).. Isoform 8. Involved in transcriptional regulation in embryonic stem cells (ESCs). Stimulates expression of transcription factors that are required for pluripotency and decreases expression of differentiation-associated genes. Has distinct DNA-binding specifities as compared to the canonical form and preferentially binds DNA with the sequence 5'-CGATACAA-3' (or closely related sequences) (PubMed : 21924763). Promotes ESC self-renewal and pluripotency (By similarity).

Product protocols

Target data

Transcriptional repressor (PubMed : 18347093, PubMed : 26647308). Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential (By similarity). Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal cord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in embryonic stem cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintenance of hair follicle stem cell quiescence; the function probably involves regulation of FGF18 (By similarity). Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis (PubMed : 25267198). Binds to CSF1R promoter elements and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes seems to involve NCOR2 as corepressor (PubMed : 15286807, PubMed : 18347093, PubMed : 18799727). Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization seems to implicate suppression of SEMA5B (PubMed : 24023716). Can negatively regulate androgen receptor signaling (PubMed : 18640093). Acts as a transcriptional activator of the FBXL7 promoter; this activity is regulated by AURKA (PubMed : 28218735).. Isoform 8. Involved in transcriptional regulation in embryonic stem cells (ESCs). Stimulates expression of transcription factors that are required for pluripotency and decreases expression of differentiation-associated genes. Has distinct DNA-binding specifities as compared to the canonical form and preferentially binds DNA with the sequence 5'-CGATACAA-3' (or closely related sequences) (PubMed : 21924763). Promotes ESC self-renewal and pluripotency (By similarity).
See full target information FOXP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com