JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114357

Recombinant Human FPRL1/RFP protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FPRL1/RFP protein (GST tag N-Terminus) is a Human Fragment protein, in the 163 to 205 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

FPRH1, FPRL1, LXA4R, FPR2, N-formyl peptide receptor 2, FMLP-related receptor I, Formyl peptide receptor-like 1, HM63, Lipoxin A4 receptor, RFP, FMLP-R-I, ALX, LXA4 receptor

1 Images
SDS-PAGE - Recombinant Human FPRL1/RFP protein (GST tag N-Terminus) (AB114357)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FPRL1/RFP protein (GST tag N-Terminus) (AB114357)

ab114357 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P25090

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as FPRL1.

Sequence info

[{"sequence":"FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR","proteinLength":"Fragment","predictedMolecularWeight":"30.36 kDa","actualMolecularWeight":null,"aminoAcidEnd":205,"aminoAcidStart":163,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P25090","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FPRL1 known also as FPR2 or formyl peptide receptor-like 1 is a G-protein-coupled receptor with an approximate mass of 39 kDa. This receptor primarily resides on the surface of immune cells such as neutrophils monocytes and dendritic cells. FPRL1 plays an important role in transmitting chemotactic signals that guide immune cells towards sites of inflammation or infection. It binds ligands that include formylated peptides and lipid mediators initiating a cascade of intracellular signals that mobilize immune responses.
Biological function summary

FPRL1 enables the immune system to detect and respond to pathogenic threats effectively. As part of the immune surveillance mechanism FPRL1 aids in the migration and function of immune cells by activating intracellular second messenger systems including calcium mobilization and MAPK pathways. Though not part of a larger protein complex it interacts closely with other signaling molecules to amplify immune responses. The receptor also shows diverse ligand recognition possibly allowing it to participate in different immune processes.

Pathways

FPRL1 holds a position in both inflammatory and resolution pathways. Notably it participates in the chemokine signaling pathway working alongside other G-protein-coupled receptors to regulate leukocyte chemotaxis. FPRL1 further involves itself in the resolution of inflammation through interactions with specialized pro-resolving mediators like lipoxins. An example of this interaction occurs with the protein ALX/FPR2 with which FPRL1 shares functional similarities contributing to both swift inflammatory responses and their resolution.

FPRL1 implicates itself in chronic inflammatory diseases and cancer. In chronic inflammatory conditions FPRL1 overstimulation may contribute to prolonged inflammation adversely affecting tissue function. Furthermore aberrant signaling through FPRL1 potentially influences tumor progression in various cancers. FPRL1 can interact with PD-L1 within the tumor microenvironment promoting immune evasion in cancer cells. Understanding these interactions offers potential therapeutic targets to modulate immune responses and treat associated disorders.

Specifications

Form

Liquid

General info

Function

Pattern recognition G protein-coupled receptor (GPCR) that recognizes peptides with N-terminal formyl methionine, which are derived from invading pathogens or host mitochondria as pathogen or damage-associated molecular patterns (PAMPs and DAMPs) (PubMed : 1374236, PubMed : 25605714, PubMed : 35217703). Preferentially recognizes longer peptides or peptides with specific sequences such as the phenol-soluble modulin (PSM) family of formylated peptide toxins produced by Staphylococcus aureus (PubMed : 30098280). Ligand binding causes a conformation change that triggers signaling via G(i)/GNAI1 inhibiting adenylate cyclase activity, leading to decreased intracellular cAMP levels (PubMed : 40080544). In addition, can recognize a variety of chemically distinct endogenous ligands including proteins and lipids besides formylpeptides and thereby plays multiple roles in inflammation. Acts as a receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity). Acts also as a ceramide membrane receptor, and long-chain ceramides (C14 to C20) binding induces conformational changes that inhibits diet-induced adipose thermogenesis (PubMed : 40080544). Participates in neuroprotection via interaction with humanin/MT-RNR2 and Amyloid-beta protein 42, product of APP (PubMed : 11689470, PubMed : 35365641). Differential signaling is also defined by receptor oligomerization state. Binding of ANXA1 to FPR2 homodimer elicits activation of p38 MAPKinase pathway leading to HSPB1/HSP27 phosphorylation and IL10 production in monocytes. Whereas agonistic activation of FPR1 : FPR2 heterodimers signals a proapoptotic JNK pathway in neutrophils.

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Product protocols

Target data

Pattern recognition G protein-coupled receptor (GPCR) that recognizes peptides with N-terminal formyl methionine, which are derived from invading pathogens or host mitochondria as pathogen or damage-associated molecular patterns (PAMPs and DAMPs) (PubMed : 1374236, PubMed : 25605714, PubMed : 35217703). Preferentially recognizes longer peptides or peptides with specific sequences such as the phenol-soluble modulin (PSM) family of formylated peptide toxins produced by Staphylococcus aureus (PubMed : 30098280). Ligand binding causes a conformation change that triggers signaling via G(i)/GNAI1 inhibiting adenylate cyclase activity, leading to decreased intracellular cAMP levels (PubMed : 40080544). In addition, can recognize a variety of chemically distinct endogenous ligands including proteins and lipids besides formylpeptides and thereby plays multiple roles in inflammation. Acts as a receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation (By similarity). Acts also as a ceramide membrane receptor, and long-chain ceramides (C14 to C20) binding induces conformational changes that inhibits diet-induced adipose thermogenesis (PubMed : 40080544). Participates in neuroprotection via interaction with humanin/MT-RNR2 and Amyloid-beta protein 42, product of APP (PubMed : 11689470, PubMed : 35365641). Differential signaling is also defined by receptor oligomerization state. Binding of ANXA1 to FPR2 homodimer elicits activation of p38 MAPKinase pathway leading to HSPB1/HSP27 phosphorylation and IL10 production in monocytes. Whereas agonistic activation of FPR1 : FPR2 heterodimers signals a proapoptotic JNK pathway in neutrophils.
See full target information FPR2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com