JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB92921

Recombinant Human Fragilis protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Fragilis protein is a Human Full Length protein, in the 1 to 133 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, ELISA, Mass Spec, WB.

View Alternative Names

Interferon-induced transmembrane protein 3, Dispanin subfamily A member 2b, Interferon-inducible protein 1-8U, DSPA2b, IFITM3

2 Images
Western blot - Recombinant Human Fragilis protein (AB92921)
  • WB

Unknown

Western blot - Recombinant Human Fragilis protein (AB92921)

All lanes:

Western blot - Anti-Fragilis antibody [EPR5242] (<a href='/en-us/products/primary-antibodies/fragilis-antibody-epr5242-ab109429'>ab109429</a>) at 1/1000 dilution

All lanes:

Western blot - Recombinant Human Fragilis protein (ab92921) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 15 kDa

true

Exposure time: 10s

SDS-PAGE - Recombinant Human Fragilis protein (AB92921)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Fragilis protein (AB92921)

ab92921 on 10% SDS-PAGE stained with Coomassie Blue. Predicted band size is 43 kDa.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, WB, Mass Spec, ELISA

applications

Biologically active

No

Accession

Q01628

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 30% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab92921 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/fragilis-antibody-epr5242-ab109429'>ab109429</a>.</p>" } } }

Sequence info

[{"sequence":"MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG","proteinLength":"Full Length","predictedMolecularWeight":"43 kDa","actualMolecularWeight":null,"aminoAcidEnd":133,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q01628","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein known as Fragilis also called Interferon-induced transmembrane protein 3 (IFITM3) plays a role in cellular defense mechanisms. Fragilis is approximately 15 kDa in mass. It is commonly expressed in cells of the immune system such as lymphocytes and can also be found in various tissues including the lungs spleen and thymus. This protein includes a chain of functional domains that interact with cellular membranes contributing to its protective roles on the cellular level.
Biological function summary

IFITM3 acts as an antiviral protein that disrupts the life cycle of viruses entering human cells. It is a part of a family of transmembrane proteins that block viral replication by inhibiting the fusion of viral membranes with endosomal membranes. The presence of Fragilis in respiratory epithelial cells is integral to the immune response against viral infections. The protein acts as a barrier to viruses like influenza providing an innate immune defense mechanism.

Pathways

The involvement of IFITM3 is central to the immune signaling pathways specifically the interferon signaling pathway. Upon viral infection interferons upregulate IFITM3 enhancing its antiviral activities. Other proteins like STAT1 and STAT2 mediate this regulation. Additionally IFITM3 aligns with the pathways regulating cell membrane integrity and remodeling highlighting its multi-functional role beyond just antiviral defense.

Research highlights the relevance of IFITM3 in conditions such as influenza and COVID-19. In both cases higher expression levels correlate with better prognosis. For instance variations in IFITM3 expression or genetic mutations can affect susceptibility to severe influenza. Connections with proteins such as MxA and other IFITM proteins can influence these disease processes. These connections make Fragilis a target of interest for understanding and potentially mitigating the severity of viral infections.

Specifications

Form

Liquid

Additional notes

Purified by 6xHis-GST tags / Immobilized-metal affinity chromatography (IMAC).

General info

Function

IFN-induced antiviral protein which disrupts intracellular cholesterol homeostasis. Inhibits the entry of viruses to the host cell cytoplasm by preventing viral fusion with cholesterol depleted endosomes. May inactivate new enveloped viruses which buds out of the infected cell, by letting them go out with a cholesterol depleted membrane. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1), hepatitis C virus (HCV) and vesicular stomatitis virus (VSV) (PubMed : 26354436, PubMed : 33239446, PubMed : 33270927). Can inhibit : influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV and SARS-CoV-2 S protein-mediated viral entry and VSV G protein-mediated viral entry (PubMed : 33270927). Plays a critical role in the structural stability and function of vacuolar ATPase (v-ATPase). Establishes physical contact with the v-ATPase of endosomes which is critical for proper clathrin localization and is also required for the function of the v-ATPase to lower the pH in phagocytic endosomes thus establishing an antiviral state. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation (PubMed : 26354436). IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome (PubMed : 26354436). Exerts opposing activities on SARS-CoV-2, including amphipathicity-dependent restriction of virus at endosomes and amphipathicity-independent enhancement of infection at the plasma membrane (PubMed : 33270927).

Sequence similarities

Belongs to the CD225/Dispanin family.

Post-translational modifications

Palmitoylation on membrane-proximal cysteines controls clustering in membrane compartments and antiviral activity against influenza virus and hepatitis C virus (HCV). Has no effect on anti-SARS-CoV-2 activity.. Not glycosylated.. Polyubiquitinated with both 'Lys-48' and 'Lys-63' linkages. Ubiquitination negatively regulates antiviral activity. Lys-24 is the most prevalent ubiquitination site.. Phosphorylation at Tyr-20 is required for endosomal and lysosomal location.

Subcellular localisation

Late endosome membrane

Product protocols

Target data

IFN-induced antiviral protein which disrupts intracellular cholesterol homeostasis. Inhibits the entry of viruses to the host cell cytoplasm by preventing viral fusion with cholesterol depleted endosomes. May inactivate new enveloped viruses which buds out of the infected cell, by letting them go out with a cholesterol depleted membrane. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1), hepatitis C virus (HCV) and vesicular stomatitis virus (VSV) (PubMed : 26354436, PubMed : 33239446, PubMed : 33270927). Can inhibit : influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV and SARS-CoV-2 S protein-mediated viral entry and VSV G protein-mediated viral entry (PubMed : 33270927). Plays a critical role in the structural stability and function of vacuolar ATPase (v-ATPase). Establishes physical contact with the v-ATPase of endosomes which is critical for proper clathrin localization and is also required for the function of the v-ATPase to lower the pH in phagocytic endosomes thus establishing an antiviral state. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation (PubMed : 26354436). IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome (PubMed : 26354436). Exerts opposing activities on SARS-CoV-2, including amphipathicity-dependent restriction of virus at endosomes and amphipathicity-independent enhancement of infection at the plasma membrane (PubMed : 33270927).
See full target information IFITM3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com