JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB223098

Recombinant Human Frizzled 4 protein (Fc tag C-Terminus + His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Frizzled 4 protein (Fc tag C-Terminus + His tag C-Terminus) is a Human Fragment protein, in the 37 to 222 aa range, expressed in Baculovirus infected insect cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD344, Frizzled-4, Fz-4, hFz4, FzE4, FZD4

1 Images
SDS-PAGE - Recombinant Human Frizzled 4 protein (Fc tag C-Terminus + His tag C-Terminus) (AB223098)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Frizzled 4 protein (Fc tag C-Terminus + His tag C-Terminus) (AB223098)

15% SDS-PAGE analysis of 3 μg ab223098.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

Fc tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9ULV1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADPFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"48.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":222,"aminoAcidStart":37,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"Q9ULV1","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Frizzled-4 also known as FZD4 is a protein important for the Wnt signaling pathway acting as a receptor for Wnt proteins. With a mass approximately 70 kDa FZD4 is a seven-transmembrane domain protein that is part of the G-protein-coupled receptor superfamily. Expression of FZD4 has been detected mostly in tissues like the retina and vasculature which suggests its role in the development and maintenance of these systems.
Biological function summary

Frizzled-4 plays a role in mediating signaling pathways that are essential for angiogenesis and retinal vascular development. It functions as a component of a larger receptor complex that includes co-receptors such as low-density lipoprotein receptor-related proteins (LRP5/6) and Disheveled proteins. This interaction is key for transmitting Wnt ligand signals to inside the cell influencing gene expression that drives cellular processes like proliferation and differentiation.

Pathways

The FZD4 protein is integral to the canonical and non-canonical Wnt signaling pathways. It actively participates in the β-catenin pathway which governs gene expression regulation by stabilizing β-catenin a process influencing various cellular activities. Moreover FZD4 is associated with the planar cell polarity pathway which is important for cell orientation processes. These pathways connect FZD4 to several other proteins like LRP5/6 and Disheveled which work in tandem to ensure proper signal transduction.

Mutations or dysregulation of Frizzled-4 are linked to familial exudative vitreoretinopathy (FEVR) a genetic disorder affecting retinal vascular development and leading to vision loss. The protein's interaction with LRP5 is significant in this context as mutations in either protein can disrupt their synergistic function resulting in the disease. Additionally aberrations in FZD4 signaling have implications in tumorigenesis particularly in cancers where Wnt signaling is pathologically activated suggesting that Frizzled-4’s role is important in maintaining tissue homeostasis.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Receptor for Wnt proteins (PubMed : 30135577). Most frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes (PubMed : 30135577). Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP) (By similarity). In retina, it can be activated by Wnt protein-binding and also by Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs (By similarity). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.

Sequence similarities

Belongs to the G-protein coupled receptor Fz/Smo family.

Post-translational modifications

Ubiquitinated by ZNRF3, leading to its degradation by the proteasome.

Product protocols

Target data

Receptor for Wnt proteins (PubMed : 30135577). Most frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes (PubMed : 30135577). Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP) (By similarity). In retina, it can be activated by Wnt protein-binding and also by Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs (By similarity). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.
See full target information Frizzled-4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com