JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276698

Recombinant Human Frizzled 6 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Frizzled 6 protein (His tag) is a Human Fragment protein, in the 1 to 153 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Frizzled-6, Fz-6, hFz6, FZD6

1 Images
SDS-PAGE - Recombinant Human Frizzled 6 protein (His tag) (AB276698)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Frizzled 6 protein (His tag) (AB276698)

SDS-PAGE analysis of ab276698

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O60353

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQV","proteinLength":"Fragment","predictedMolecularWeight":"17.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":153,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O60353","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Frizzled 6 also known as FZD6 is a receptor encoded by the FZD6 gene that plays an important role in Wnt signaling. Frizzled 6 is a transmembrane protein part of the Frizzled family which typically contains seven transmembrane domains. It has a molecular mass of approximately 75 kDa. Expression of Frizzled 6 occurs in various tissues including the brain lung pancreas and kidney highlighting its diverse functional significance within the body.
Biological function summary

Frizzled 6 acts as a receptor in the Wnt signaling pathway which is important in cellular communication and regulation. It does not function alone; it is part of a complex network involving other Frizzled proteins and Wnt ligands that are key for processes such as cell proliferation differentiation and migration. This signaling is important for maintaining proper cellular responses and is integral to developmental processes.

Pathways

Frizzled 6 integrates into the non-canonical Wnt signaling pathway which diverges from the canonical pathway by not involving β-catenin. In this pathway it cooperates with key proteins like Disheveled (DVL) and forms complexes with Wnt ligands to elicit specific cellular responses. This engagement is essential for tailoring responses to external cellular cues especially in processes like tissue polarity and neural tube closure during embryonic development.

Frizzled 6 relates to diseases such as neural tube defects and some forms of cancer. Alterations in Frizzled 6 expression or function can interfere with Wnt signaling integrity leading to such conditions. In these disease states interactions with Wnt ligands and other proteins involved in this signaling pathway including Disheveled underline the receptor’s importance and the risk related to its dysregulation. Understanding Frizzled 6's involvement could lead to targeted therapeutic approaches for these conditions.

Specifications

Form

Lyophilized

General info

Function

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Together with FZD3, is involved in the neural tube closure and plays a role in the regulation of the establishment of planar cell polarity (PCP), particularly in the orientation of asymmetric bundles of stereocilia on the apical faces of a subset of auditory and vestibular sensory cells located in the inner ear (By similarity).

Sequence similarities

Belongs to the G-protein coupled receptor Fz/Smo family.

Post-translational modifications

Ubiquitinated by ZNRF3, leading to its degradation by the proteasome.

Product protocols

Target data

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Together with FZD3, is involved in the neural tube closure and plays a role in the regulation of the establishment of planar cell polarity (PCP), particularly in the orientation of asymmetric bundles of stereocilia on the apical faces of a subset of auditory and vestibular sensory cells located in the inner ear (By similarity).
See full target information FZD6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com