JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271524

Recombinant Human Frizzled 7 protein (Fc tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Frizzled 7 protein (Fc tag C-Terminus) is a Human Fragment protein, in the 33 to 185 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

Frizzled-7, Fz-7, hFz7, FzE3, FZD7

1 Images
SDS-PAGE - Recombinant Human Frizzled 7 protein (Fc tag C-Terminus) (AB271524)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Frizzled 7 protein (Fc tag C-Terminus) (AB271524)

SDS-PAGE analysis of 2 μg ab271524.

This protein runs at a higher apparent MW by SDS-PAGE due to glycosylation.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O75084

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.48% Tris, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>This protein runs at a higher apparent MW by SDS-PAGE due to glycosylation.</p>" } } }

Sequence info

[{"sequence":"QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL","proteinLength":"Fragment","predictedMolecularWeight":"43.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":185,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O75084","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Frizzled 7 also known as Frizzled receptor or Frizzled protein is a transmembrane receptor weighing approximately 75 kDa. This member of the Frizzled family acts as a receptor for Wnt proteins and plays a role in the transmission of extracellular signals to the cytoplasm. Frizzled 7 is expressed in various tissues but shows prevalent expression in organs like the intestine and kidney. The receptor's structure includes a distinctive cysteine-rich domain essential for ligand binding which sets it apart in the family of Frizzled receptors.
Biological function summary

Frizzled 7 functions in cellular processes such as regulating cell proliferation migration and differentiation. It interacts closely with Dishevelled proteins to activate downstream signaling cascades. As part of a signaling complex Frizzled 7 influences the stabilization and localization of key signaling molecules within the Wnt/β-catenin pathway. This protein's role is vital in maintaining cellular responses necessary for tissue homeostasis and development.

Pathways

Wnt/β-catenin and planar cell polarity pathways are the primary pathways involving Frizzled 7. The Wnt/β-catenin pathway sees this receptor interacting with proteins like LRP5/6 and β-catenin to regulate gene expression. Through these pathways Frizzled 7 helps balance cellular activities that ensure proper tissue growth and repair. These pathways highlight its coordination with other Frizzled receptors to bring about specific cellular responses.

Frizzled 7 has been linked to colorectal cancer and kidney diseases. Alterations in the Wnt signaling pathways where Frizzled 7 takes part can lead to uncontrolled cell proliferation contributing to tumor progression. Frizzled 7 has shown significant interactions with proteins such as APC in the development of colorectal cancer. Additionally its atypical expression levels may correlate with kidney disease progression linking it to aberrations in cellular signaling that disrupt normal kidney function. These connections highlight the receptor's potential as a therapeutic target in these disorders.

Specifications

Form

Liquid

General info

Function

Receptor for Wnt proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Activation by WNT8 induces expression of beta-catenin target genes (By similarity). Following ligand activation, binds to CCDC88C/DAPLE which displaces DVL1 from FZD7 and leads to inhibition of canonical Wnt signaling, activation of G-proteins by CCDC88C and triggering of non-canonical Wnt responses (PubMed : 26126266). May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.. (Microbial infection) Acts as a receptor for C.difficile toxin TcdB in the colonic epithelium.

Sequence similarities

Belongs to the G-protein coupled receptor Fz/Smo family.

Post-translational modifications

Ubiquitinated by ZNRF3, leading to its degradation by the proteasome.

Subcellular localisation

Endosome membrane

Product protocols

Target data

Receptor for Wnt proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Activation by WNT8 induces expression of beta-catenin target genes (By similarity). Following ligand activation, binds to CCDC88C/DAPLE which displaces DVL1 from FZD7 and leads to inhibition of canonical Wnt signaling, activation of G-proteins by CCDC88C and triggering of non-canonical Wnt responses (PubMed : 26126266). May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.. (Microbial infection) Acts as a receptor for C.difficile toxin TcdB in the colonic epithelium.
See full target information FZD7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com