JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB165435

Recombinant Human FUNDC1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FUNDC1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 155 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

FUN14 domain-containing protein 1, FUNDC1

1 Images
SDS-PAGE - Recombinant Human FUNDC1 protein (GST tag N-Terminus) (AB165435)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FUNDC1 protein (GST tag N-Terminus) (AB165435)

ab165435 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q8IVP5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":155,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8IVP5","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

FUNDC1 also known as FUN14 domain-containing protein 1 is a protein involved in mitochondrial dynamics. It weighs approximately 15 kDa. FUNDC1 is primarily expressed in the mitochondrial outer membrane and shows high expression levels in tissues with high energy demands such as the heart and skeletal muscles. Its function is linked to the regulation of mitophagy a process that removes damaged mitochondria.
Biological function summary

FUNDC1 plays a role in the selective elimination of mitochondria through mitophagy. It acts as a receptor for damaged mitochondria binding to LC3 and enabling the autophagic machinery. FUNDC1 is not known to be part of a larger protein complex but it interacts with other mitophagy-related proteins such as PGAM5 and ULK1 to facilitate mitochondrial clearance.

Pathways

FUNDC1 participates in the mitophagy pathway and the broader mitochondrial quality control pathway. In the mitophagy pathway its interaction with proteins like LC3 facilitates the engulfment of dysfunctional mitochondria by autophagosomes. The relationship of FUNDC1 with ULK1 highlights its role in the initiation of the mitophagy signaling cascade ensuring mitochondrial integrity and cellular homeostasis.

FUNDC1 has associations with neurodegenerative diseases and cardiovascular disorders. Defects in the mitophagy process where FUNDC1 plays a significant role can contribute to the development of Parkinson's disease. Furthermore its connection to cardiovascular diseases involves interactions with BCL2L1 a protein that regulates apoptosis in heart tissue under stress conditions. Dysfunctional FUNDC1 activity may lead to the accumulation of damaged mitochondria contributing to cellular dysfunction observed in these diseases.

Specifications

Form

Liquid

General info

Function

Integral mitochondrial outer-membrane protein that mediates the formation of mitochondria-associated endoplasmic reticulum membranes (MAMs) (PubMed : 33972548). In turn, mediates angiogenesis and neoangiogenesis through interference with intracellular Ca(2+) communication and regulation of the vascular endothelial growth factor receptor KDR/VEGFR2 expression at both mRNA and protein levels (PubMed : 33972548). Also acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality and homeostasis, by interacting with and recruiting LC3 protein family to mitochondria (PubMed : 22267086, PubMed : 24671035, PubMed : 24746696, PubMed : 27653272). Mechanistically, recruits DRP1 at ER-mitochondria contact sites leading to DRP1 oligomerization and GTPase activity to facilitate mitochondrial fission during hypoxia (PubMed : 27145933, PubMed : 33978709). Additionally, plays a role in hepatic ferroptosis by interacting directly with glutathione peroxidase/GPX4 to facilitate its recruitment into mitochondria through TOM/TIM complex where it is degraded by mitophagy (PubMed : 36828120).

Sequence similarities

Belongs to the FUN14 family.

Post-translational modifications

Phosphorylation at Ser-13 by CK2 and at Tyr-18 by SRC inhibits activation of mitophagy. Following hypoxia, dephosphorylated at Tyr-18, leading to interaction with MAP1 LC3 family proteins and triggering mitophagy. Dephosphorylation is mediated by PGAM5 (PubMed:24746696). Phosphorylated by ULK1 at Ser-17 which enhances FUNDC1 binding to LC3 (PubMed:24671035).. Ubiquitinated on Lys-119. Deubiquitinated by USP19; leading to hypoxia-induced DRP1 oligomerization and GTPase activity.

Subcellular localisation

Mitochondrion outer membrane

Product protocols

Target data

Integral mitochondrial outer-membrane protein that mediates the formation of mitochondria-associated endoplasmic reticulum membranes (MAMs) (PubMed : 33972548). In turn, mediates angiogenesis and neoangiogenesis through interference with intracellular Ca(2+) communication and regulation of the vascular endothelial growth factor receptor KDR/VEGFR2 expression at both mRNA and protein levels (PubMed : 33972548). Also acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality and homeostasis, by interacting with and recruiting LC3 protein family to mitochondria (PubMed : 22267086, PubMed : 24671035, PubMed : 24746696, PubMed : 27653272). Mechanistically, recruits DRP1 at ER-mitochondria contact sites leading to DRP1 oligomerization and GTPase activity to facilitate mitochondrial fission during hypoxia (PubMed : 27145933, PubMed : 33978709). Additionally, plays a role in hepatic ferroptosis by interacting directly with glutathione peroxidase/GPX4 to facilitate its recruitment into mitochondria through TOM/TIM complex where it is degraded by mitophagy (PubMed : 36828120).
See full target information FUN14 domain-containing protein 1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com