JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114288

Recombinant Human FUT4 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FUT4 protein is a Human Fragment protein, in the 167 to 265 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

ELFT, FCT3A, FUT4, 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase, ELAM-1 ligand fucosyltransferase, Fucosyltransferase 4, Fucosyltransferase IV, Galactoside 3-L-fucosyltransferase, Fuc-TIV, FucT-IV

1 Images
SDS-PAGE - Recombinant Human FUT4 protein (AB114288)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FUT4 protein (AB114288)

12.5% SDS-PAGE image showing ab114288 at approximately 36.52 kDa, stained by Commassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

P22083

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(for recombinant protein).</p>" } } }

Sequence info

[{"sequence":"ITYACWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDL","proteinLength":"Fragment","predictedMolecularWeight":"36.52 kDa","actualMolecularWeight":null,"aminoAcidEnd":265,"aminoAcidStart":167,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P22083","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The FUT4 protein also known as fucosyltransferase 4 or CD15 plays an essential role in glycosylation processes by adding fucose to glycolipids and glycoproteins. This enzyme is responsible for the synthesis of Lewis X antigens. FUT4 has a molecular mass of around 44 kDa and is expressed prominently in myeloid cells such as neutrophils and monocytes. It exhibits a significant presence in the bone marrow and expressed on the surface of certain leukocytes.
Biological function summary

The activity of FUT4 is important for cell adhesion migration and immune response modulation. It helps in the formation of selectin ligands which mediate cell-to-cell interactions through the binding of selectins on endothelial cells. FUT4 does not form a larger protein complex but interacts with substrates and cofactors to achieve its function. Its role is particularly significant in the context of inflammation and hematopoiesis.

Pathways

FUT4 is involved in the biosynthesis of glycoconjugates especially influencing the E-selectin and P-selectin pathways. These pathways are integral to leukocyte trafficking during inflammatory responses. FUT4 activity shows a functional relationship with other fucosyltransferases including FUT3 and FUT5 which also participate in modifying glycolipids and glycoproteins. This makes FUT4 a part of the larger network regulating cell-surface carbohydrate structures.

FUT4 has been linked to chronic inflammatory diseases and Leukocyte Adhesion Deficiency II. Aberrations in FUT4 expression can lead to altered selectin-mediated adhesion impacting immune cell recruitment. Additionally FUT4 involvement in cancer has attracted attention as changes in its activity can impact tumor cell metastasis. It is also worthwhile to note pathways with E-selectin can influence its disease association highlighting possible therapeutic targets in E-selectin-related disorders.

Specifications

Form

Liquid

General info

Function

Isoform Short. Catalyzes alpha(1->3) linkage of fucosyl moiety transferred from GDP-beta-L-fucose to N-acetyl glucosamine (GlcNAc) within type 2 lactosamine (LacNAc, Gal-beta(1->4)GlcNAc) glycan attached to N- or O-linked glycoproteins (PubMed : 1702034, PubMed : 1716630, PubMed : 29593094). Robustly fucosylates nonsialylated distal LacNAc unit of the polylactosamine chain to form Lewis X antigen (CD15), a glycan determinant known to mediate important cellular functions in development and immunity. Fucosylates with lower efficiency sialylated LacNAc acceptors to form sialyl Lewis X and 6-sulfo sialyl Lewis X determinants that serve as recognition epitopes for C-type lectins (PubMed : 1716630, PubMed : 29593094). Together with FUT7 contributes to SELE, SELL and SELP selectin ligand biosynthesis and selectin-dependent lymphocyte homing, leukocyte migration and blood leukocyte homeostasis (By similarity). In a cell type specific manner, may also fucosylate the internal LacNAc unit of the polylactosamine chain to form VIM-2 antigen that serves as recognition epitope for SELE (PubMed : 11278338, PubMed : 1716630).. Isoform Long. Does not generate Lewis X antigens.

Sequence similarities

Belongs to the glycosyltransferase 10 family.

Product protocols

Target data

Isoform Short. Catalyzes alpha(1->3) linkage of fucosyl moiety transferred from GDP-beta-L-fucose to N-acetyl glucosamine (GlcNAc) within type 2 lactosamine (LacNAc, Gal-beta(1->4)GlcNAc) glycan attached to N- or O-linked glycoproteins (PubMed : 1702034, PubMed : 1716630, PubMed : 29593094). Robustly fucosylates nonsialylated distal LacNAc unit of the polylactosamine chain to form Lewis X antigen (CD15), a glycan determinant known to mediate important cellular functions in development and immunity. Fucosylates with lower efficiency sialylated LacNAc acceptors to form sialyl Lewis X and 6-sulfo sialyl Lewis X determinants that serve as recognition epitopes for C-type lectins (PubMed : 1716630, PubMed : 29593094). Together with FUT7 contributes to SELE, SELL and SELP selectin ligand biosynthesis and selectin-dependent lymphocyte homing, leukocyte migration and blood leukocyte homeostasis (By similarity). In a cell type specific manner, may also fucosylate the internal LacNAc unit of the polylactosamine chain to form VIM-2 antigen that serves as recognition epitope for SELE (PubMed : 11278338, PubMed : 1716630).. Isoform Long. Does not generate Lewis X antigens.
See full target information FUT4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com