JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152840

Recombinant Human FXR1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FXR1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 121 to 220 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

RNA-binding protein FXR1, FMR1 autosomal homolog 1, hFXR1p, FXR1

1 Images
SDS-PAGE - Recombinant Human FXR1 protein (GST tag N-Terminus) (AB152840)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human FXR1 protein (GST tag N-Terminus) (AB152840)

12.5% SDS-PAGE analysis of ab152840 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

P51114

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFH","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":220,"aminoAcidStart":121,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P51114","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The FXR1 protein also known as Fragile X Mental Retardation Syndrome-related Protein 1 weighs approximately 80 kDa and is expressed in various tissues including the brain heart and the skeletal muscles. It belongs to the family of RNA-binding proteins that also includes FMR1 and FXR2. Mechanically FXR1 interacts with mRNA participating in the regulation of its stability and translation. This regulation allows cells to control protein synthesis important for many cellular processes.
Biological function summary

FXR1 is involved in the post-transcriptional regulation of gene expression important for normal cell function and development. It forms a complex with FMRP playing an important role in the transport and translation of specific subsets of mRNAs in neurons. This interaction suggests it contributes significantly to the synaptic plasticity mechanisms influencing learning and memory. Moreover FXR1 also seems to have functions in cell proliferation and muscle differentiation.

Pathways

FXR1 participates in key regulatory pathways of protein synthesis and neuronal communication. It is significant in the mTOR signaling pathway where it potentially interacts with other proteins like FXR2 and FMR1 to modulate translational control. FXR1's involvement in this pathway suggests a role in cellular growth and neuron-specific processes affecting how cells respond to various growth signals by altering protein synthesis rates.

FXR1 links to psychiatric disorders including schizophrenia and bipolar disorder. Gene dysregulation in FXR1 may disrupt normal synaptic functioning contributing to the pathophysiology of these conditions. In muscular dystrophies altered FXR1 expression has been reported associating it with muscle tissue protein dynamics along with FMR1 influencing muscle regeneration and repair mechanisms. These associations highlight FXR1’s potential as a therapeutic target in neurodevelopmental and muscle-related diseases.

Specifications

Form

Liquid

General info

Function

mRNA-binding protein that acts as a regulator of mRNAs translation and/or stability, and which is required for various processes, such as neurogenesis, muscle development and spermatogenesis (PubMed : 17382880, PubMed : 20417602, PubMed : 30067974, PubMed : 34731628, PubMed : 35989368, PubMed : 36306353). Specifically binds to AU-rich elements (AREs) in the 3'-UTR of target mRNAs (PubMed : 17382880, PubMed : 34731628). Promotes formation of some phase-separated membraneless compartment by undergoing liquid-liquid phase separation upon binding to AREs-containing mRNAs, leading to assemble mRNAs into cytoplasmic ribonucleoprotein granules that concentrate mRNAs with associated regulatory factors (By similarity). Required to activate translation of stored mRNAs during late spermatogenesis : acts by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules that recruit translation initiation factor EIF4G3 to activate translation of stored mRNAs in late spermatids (By similarity). Promotes translation of MYC transcripts by recruiting the eIF4F complex to the translation start site (PubMed : 34731628). Acts as a negative regulator of inflammation in response to IL19 by promoting destabilization of pro-inflammatory transcripts (PubMed : 30067974). Also acts as an inhibitor of inflammation by binding to TNF mRNA, decreasing TNF protein production (By similarity). Acts as a negative regulator of AMPA receptor GRIA2/GluA2 synthesis during long-lasting synaptic potentiation of hippocampal neurons by binding to GRIA2/GluA2 mRNA, thereby inhibiting its translation (By similarity). Regulates proliferation of adult neural stem cells by binding to CDKN1A mRNA and promoting its expression (By similarity). Acts as a regulator of sleep and synaptic homeostasis by regulating translation of transcripts in neurons (By similarity). Required for embryonic and postnatal development of muscle tissue by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules (PubMed : 30770808). Involved in the nuclear pore complex localization to the nuclear envelope by preventing cytoplasmic aggregation of nucleoporins : acts by preventing ectopic phase separation of nucleoporins in the cytoplasm via a microtubule-dependent mechanism (PubMed : 32706158). Plays a role in the stabilization of PKP2 mRNA and therefore protein abundance, via its interaction with PKP3 (PubMed : 25225333). May also do the same for PKP2, PKP3 and DSP via its interaction with PKP1 (PubMed : 25225333). Forms a cytoplasmic messenger ribonucleoprotein (mRNP) network by packaging long mRNAs, serving as a scaffold that recruits proteins and signaling molecules. This network facilitates signaling reactions by maintaining proximity between kinases and substrates, crucial for processes like actomyosin reorganization (PubMed : 39106863).

Sequence similarities

Belongs to the FMR1 family.

Post-translational modifications

Phosphorylation at Ser-420 by PAK1 promotes its relocalization to stress granules and activity (PubMed:20417602). Phosphorylated by MAPK1/ERK2, promoting subsequent phosphorylation by GSK3B (By similarity). Phosphorylated by GSK3B, promoting ubiquitination and degradation by the proteasome (By similarity).. Ubiquitinated by the SCF(FBXO4) complex, leading to its degradation by the proteasome: ubiquitination by the SCF(FBXO4) complex takes place following phosphorylation by GSK3B (PubMed:29142209). Ubiquitinated and degraded in a GSK3B-dependent manner in during both scaling and sleep deprivation (By similarity). Ubiquitinated via 'Lys-63'-linked ubiquitin, leading to its degradation: interaction with CEP63 inhibits 'Lys-63'-linked ubiquitination (PubMed:35989368).

Product protocols

Target data

mRNA-binding protein that acts as a regulator of mRNAs translation and/or stability, and which is required for various processes, such as neurogenesis, muscle development and spermatogenesis (PubMed : 17382880, PubMed : 20417602, PubMed : 30067974, PubMed : 34731628, PubMed : 35989368, PubMed : 36306353). Specifically binds to AU-rich elements (AREs) in the 3'-UTR of target mRNAs (PubMed : 17382880, PubMed : 34731628). Promotes formation of some phase-separated membraneless compartment by undergoing liquid-liquid phase separation upon binding to AREs-containing mRNAs, leading to assemble mRNAs into cytoplasmic ribonucleoprotein granules that concentrate mRNAs with associated regulatory factors (By similarity). Required to activate translation of stored mRNAs during late spermatogenesis : acts by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules that recruit translation initiation factor EIF4G3 to activate translation of stored mRNAs in late spermatids (By similarity). Promotes translation of MYC transcripts by recruiting the eIF4F complex to the translation start site (PubMed : 34731628). Acts as a negative regulator of inflammation in response to IL19 by promoting destabilization of pro-inflammatory transcripts (PubMed : 30067974). Also acts as an inhibitor of inflammation by binding to TNF mRNA, decreasing TNF protein production (By similarity). Acts as a negative regulator of AMPA receptor GRIA2/GluA2 synthesis during long-lasting synaptic potentiation of hippocampal neurons by binding to GRIA2/GluA2 mRNA, thereby inhibiting its translation (By similarity). Regulates proliferation of adult neural stem cells by binding to CDKN1A mRNA and promoting its expression (By similarity). Acts as a regulator of sleep and synaptic homeostasis by regulating translation of transcripts in neurons (By similarity). Required for embryonic and postnatal development of muscle tissue by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules (PubMed : 30770808). Involved in the nuclear pore complex localization to the nuclear envelope by preventing cytoplasmic aggregation of nucleoporins : acts by preventing ectopic phase separation of nucleoporins in the cytoplasm via a microtubule-dependent mechanism (PubMed : 32706158). Plays a role in the stabilization of PKP2 mRNA and therefore protein abundance, via its interaction with PKP3 (PubMed : 25225333). May also do the same for PKP2, PKP3 and DSP via its interaction with PKP1 (PubMed : 25225333). Forms a cytoplasmic messenger ribonucleoprotein (mRNP) network by packaging long mRNAs, serving as a scaffold that recruits proteins and signaling molecules. This network facilitates signaling reactions by maintaining proximity between kinases and substrates, crucial for processes like actomyosin reorganization (PubMed : 39106863).
See full target information Fragile X mental retardation syndrome-related protein 1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com