JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276706

Recombinant Human FZD10 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human FZD10 protein (His tag) is a Human Fragment protein, in the 1 to 161 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD350, Frizzled-10, Fz-10, hFz10, FzE7, FZD10

1 Images
SDS-PAGE - Recombinant Human FZD10 protein (His tag) (AB276706)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human FZD10 protein (His tag) (AB276706)

SDS-PAGE analysis of ab276706

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9ULW2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRG","proteinLength":"Fragment","predictedMolecularWeight":"17.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":161,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9ULW2","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Frizzled-10 (FZD10) also known as CD350 is a receptor in the frizzled family of proteins. It acts as a receptor for Wnt signaling proteins typically involved in communications between cells. The receptor belongs to the larger group of G-protein-coupled receptors and contains a seven-transmembrane domain structure. Its molecular mass is about 64 kDa. FZD10 is prominently expressed in various tissues including the brain and certain regions of the gastrointestinal tract with higher expression often seen in fetal tissues compared to adult tissues.
Biological function summary

FZD10 plays a significant role in the Wnt signaling pathway that affects cell development differentiation and proliferation. It usually forms part of a receptor complex that includes other proteins like LRP5/6 and Dishevelled. The interaction of FZD10 with Wnt ligands activates downstream signaling cascades important for embryonic development and maintaining stem cell states. Its involvement in these processes underlines its role in regulating key cellular dynamics.

Pathways

FZD10 is central to both the canonical Wnt/β-catenin pathway and non-canonical Wnt pathways. These pathways orchestrate critical cellular functions such as gene expression cytoskeletal arrangement and cellular movement. FZD10 collaborates closely with other frizzled receptors and Wnt proteins like Wnt3a to modulate these pathways. By regulating the stabilization and localization of β-catenin FZD10 influences various downstream target genes essential for cellular activities.

FZD10 shows association with certain cancers particularly synovial sarcoma and colon cancer. Misregulated expression of FZD10 contributes to oncogenic processes by abnormally activating Wnt signaling pathways which in turn affects cellular proliferation and survival. Additionally its association with Wnt signaling proteins such as β-catenin in these disease states emphasizes its impact on tumorigenesis and progression. Understanding FZD10's role offers potential therapeutic targets for interventions in cancers where this pathway is implicated.

Specifications

Form

Lyophilized

General info

Function

Receptor for Wnt proteins. Functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).

Sequence similarities

Belongs to the G-protein coupled receptor Fz/Smo family.

Post-translational modifications

Ubiquitinated by ZNRF3, leading to its degradation by the proteasome.

Product protocols

Target data

Receptor for Wnt proteins. Functions in the canonical Wnt/beta-catenin signaling pathway (By similarity). The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).
See full target information FZD10

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com