JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB78834

Recombinant Human GC1q R protein (Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human GC1q R protein (Tag Free) is a Human Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

GC1QBP, HABP1, SF2P32, C1QBP, ASF/SF2-associated protein p32, Glycoprotein gC1qBP, Hyaluronan-binding protein 1, Mitochondrial matrix protein p32, gC1q-R protein, p33, C1qBP, SF2AP32

1 Images
SDS-PAGE - Recombinant Human GC1q R protein (Tag Free) (AB78834)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human GC1q R protein (Tag Free) (AB78834)

15% SDS-PAGE showing ab78834 (3μg).
Note : Real molecular weight on SDS-PAGE is shifted up compared to predicted molecular weight.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q07021

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 20% Glycerol (glycerin, glycerine), 0.242% Tris, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q07021","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The gC1qR also known as gC1q-binding protein or C1qbp is a multifunctional protein involved in various cellular processes. It has an approximate mass of 33 kDa and is widely expressed on the cell surface mitochondria and in the cytoplasm of different cell types. gC1qR interacts with several ligands including C1q involved in the classical complement pathway. Its versatility in binding interactions allows it to influence several cellular environments and functions.
Biological function summary

GC1qR takes part in complement activation and immune surveillance by interacting with the complement C1 complex and various plasma proteins. As a component of high-molecular-weight complexes it modulates important cellular processes like inflammation apoptosis and infection regulation. Its presence on the mitochondrial membrane suggests a role in maintaining mitochondrial dynamics and function under stress conditions. By engaging in these arenas gC1qR serves as an intermediary in cellular signaling and immune response.

Pathways

GC1qR is significant in the classical complement pathway and apoptotic signaling pathways. It interacts with proteins like C1q and thrombomodulin influencing complement activation and coagulation pathways. It contributes to the propagation of immune responses by enhancing the interface between innate and adaptive immunity. Its interactions within these pathways highlight its role in maintaining cellular homeostasis and responding to environmental challenges.

GC1qR associates closely with systemic lupus erythematosus and cancer. Dysregulation in its expression or function can lead to aberrant immune responses and contribute to autoimmune diseases. In the context of cancer gC1qR may interact with proteins such as HMGB1 and annexin A2 affecting tumor progression and metastasis. Understanding its role in these disorders aids in exploring potential therapeutic strategies targeting gC1qR interactions.

Specifications

Form

Liquid

Additional notes

ab78834 is purified using conventional chromatography techniques.

General info

Function

Multifunctional and multicompartmental protein involved in inflammation and infection processes, ribosome biogenesis, protein synthesis in mitochondria, regulation of apoptosis, transcriptional regulation and pre-mRNA splicing (PubMed : 10022843, PubMed : 10479529, PubMed : 10722602, PubMed : 11086025, PubMed : 11859136, PubMed : 15243141, PubMed : 16140380, PubMed : 16177118, PubMed : 17881511, PubMed : 18676636, PubMed : 19004836, PubMed : 19164550, PubMed : 20810993, PubMed : 21536856, PubMed : 21544310, PubMed : 22700724, PubMed : 28942965, PubMed : 8662673, PubMed : 8710908, PubMed : 9461517). At the cell surface is thought to act as an endothelial receptor for plasma proteins of the complement and kallikrein-kinin cascades (PubMed : 10479529, PubMed : 11859136, PubMed : 8662673, PubMed : 8710908). Putative receptor for C1q; specifically binds to the globular 'heads' of C1q thus inhibiting C1; may perform the receptor function through a complex with C1qR/CD93 (PubMed : 20810993, PubMed : 8195709). In complex with cytokeratin-1/KRT1 is a high affinity receptor for kininogen-1/HMWK (PubMed : 21544310). Can also bind other plasma proteins, such as coagulation factor XII leading to its autoactivation. May function to bind initially fluid kininogen-1 to the cell membrane. The secreted form may enhance both extrinsic and intrinsic coagulation pathways. It is postulated that the cell surface form requires docking with transmembrane proteins for downstream signaling which might be specific for a cell-type or response. By acting as C1q receptor is involved in chemotaxis of immature dendritic cells and neutrophils and is proposed to signal through CD209/DC-SIGN on immature dendritic cells, through integrin alpha-4/beta-1 during trophoblast invasion of the decidua, and through integrin beta-1 during endothelial cell adhesion and spreading (PubMed : 16140380, PubMed : 22700724, PubMed : 9461517). Signaling involved in inhibition of innate immune response is implicating the PI3K-AKT/PKB pathway (PubMed : 16177118). Required for protein synthesis in mitochondria (PubMed : 28942965). In mitochondrial translation may be involved in formation of functional 55S mitoribosomes; the function seems to involve its RNA-binding activity (By similarity). May be involved in the nucleolar ribosome maturation process; the function may involve the exchange of FBL for RRP1 in the association with pre-ribosome particles (By similarity). Involved in regulation of RNA splicing by inhibiting the RNA-binding capacity of SRSF1 and its phosphorylation (PubMed : 10022843, PubMed : 21536856). Is required for the nuclear translocation of splicing factor U2AF1L4 (By similarity). Involved in regulation of CDKN2A- and HRK-mediated apoptosis. Stabilizes mitochondrial CDKN2A isoform smARF (PubMed : 17486078). May be involved in regulation of FOXC1 transcriptional activity and NFY/CCAAT-binding factor complex-mediated transcription (PubMed : 15243141, PubMed : 18676636). May play a role in antibacterial defense as it can bind to cell surface hyaluronan and inhibit Streptococcus pneumoniae hyaluronate lyase (PubMed : 19004836). May be involved in modulation of the immune response; ligation by HCV core protein is resulting in suppression of interleukin-12 production in monocyte-derived dendritic cells (PubMed : 11086025, PubMed : 17881511). Involved in regulation of antiviral response by inhibiting RIGI- and IFIH1-mediated signaling pathways probably involving its association with MAVS after viral infection (PubMed : 19164550). Acts as a regulator of DNA repair via homologous recombination by inhibiting the activity of MRE11 : interacts with unphosphorylated MRE11 and RAD50 in absence of DNA damage, preventing formation and activity of the MRN complex. Following DNA damage, dissociates from phosphorylated MRE11, allowing formation of the MRN complex (PubMed : 31353207).. (Microbial infection) Involved in HIV-1 replication, presumably by contributing to splicing of viral RNA.. (Microbial infection) In infection processes acts as an attachment site for microbial proteins, including Listeria monocytogenes internalin B (InlB) and Staphylococcus aureus protein A.. (Microbial infection) Involved in replication of Rubella virus.

Sequence similarities

Belongs to the MAM33 family.

Subcellular localisation

Mitochondrion matrix

Product protocols

Target data

Multifunctional and multicompartmental protein involved in inflammation and infection processes, ribosome biogenesis, protein synthesis in mitochondria, regulation of apoptosis, transcriptional regulation and pre-mRNA splicing (PubMed : 10022843, PubMed : 10479529, PubMed : 10722602, PubMed : 11086025, PubMed : 11859136, PubMed : 15243141, PubMed : 16140380, PubMed : 16177118, PubMed : 17881511, PubMed : 18676636, PubMed : 19004836, PubMed : 19164550, PubMed : 20810993, PubMed : 21536856, PubMed : 21544310, PubMed : 22700724, PubMed : 28942965, PubMed : 8662673, PubMed : 8710908, PubMed : 9461517). At the cell surface is thought to act as an endothelial receptor for plasma proteins of the complement and kallikrein-kinin cascades (PubMed : 10479529, PubMed : 11859136, PubMed : 8662673, PubMed : 8710908). Putative receptor for C1q; specifically binds to the globular 'heads' of C1q thus inhibiting C1; may perform the receptor function through a complex with C1qR/CD93 (PubMed : 20810993, PubMed : 8195709). In complex with cytokeratin-1/KRT1 is a high affinity receptor for kininogen-1/HMWK (PubMed : 21544310). Can also bind other plasma proteins, such as coagulation factor XII leading to its autoactivation. May function to bind initially fluid kininogen-1 to the cell membrane. The secreted form may enhance both extrinsic and intrinsic coagulation pathways. It is postulated that the cell surface form requires docking with transmembrane proteins for downstream signaling which might be specific for a cell-type or response. By acting as C1q receptor is involved in chemotaxis of immature dendritic cells and neutrophils and is proposed to signal through CD209/DC-SIGN on immature dendritic cells, through integrin alpha-4/beta-1 during trophoblast invasion of the decidua, and through integrin beta-1 during endothelial cell adhesion and spreading (PubMed : 16140380, PubMed : 22700724, PubMed : 9461517). Signaling involved in inhibition of innate immune response is implicating the PI3K-AKT/PKB pathway (PubMed : 16177118). Required for protein synthesis in mitochondria (PubMed : 28942965). In mitochondrial translation may be involved in formation of functional 55S mitoribosomes; the function seems to involve its RNA-binding activity (By similarity). May be involved in the nucleolar ribosome maturation process; the function may involve the exchange of FBL for RRP1 in the association with pre-ribosome particles (By similarity). Involved in regulation of RNA splicing by inhibiting the RNA-binding capacity of SRSF1 and its phosphorylation (PubMed : 10022843, PubMed : 21536856). Is required for the nuclear translocation of splicing factor U2AF1L4 (By similarity). Involved in regulation of CDKN2A- and HRK-mediated apoptosis. Stabilizes mitochondrial CDKN2A isoform smARF (PubMed : 17486078). May be involved in regulation of FOXC1 transcriptional activity and NFY/CCAAT-binding factor complex-mediated transcription (PubMed : 15243141, PubMed : 18676636). May play a role in antibacterial defense as it can bind to cell surface hyaluronan and inhibit Streptococcus pneumoniae hyaluronate lyase (PubMed : 19004836). May be involved in modulation of the immune response; ligation by HCV core protein is resulting in suppression of interleukin-12 production in monocyte-derived dendritic cells (PubMed : 11086025, PubMed : 17881511). Involved in regulation of antiviral response by inhibiting RIGI- and IFIH1-mediated signaling pathways probably involving its association with MAVS after viral infection (PubMed : 19164550). Acts as a regulator of DNA repair via homologous recombination by inhibiting the activity of MRE11 : interacts with unphosphorylated MRE11 and RAD50 in absence of DNA damage, preventing formation and activity of the MRN complex. Following DNA damage, dissociates from phosphorylated MRE11, allowing formation of the MRN complex (PubMed : 31353207).. (Microbial infection) Involved in HIV-1 replication, presumably by contributing to splicing of viral RNA.. (Microbial infection) In infection processes acts as an attachment site for microbial proteins, including Listeria monocytogenes internalin B (InlB) and Staphylococcus aureus protein A.. (Microbial infection) Involved in replication of Rubella virus.
See full target information C1QBP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com