JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB268694

Recombinant human GCN5L2 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human GCN5L2 protein (Active) is a Human Fragment protein, in the 323 to 837 aa range, expressed in Baculovirus infected Sf9 cells, with >85%, suitable for SDS-PAGE, FuncS.

View Alternative Names

GCN5, GCN5L2, KAT2A, Histone acetyltransferase KAT2A, General control of amino acid synthesis protein 5-like 2, Histone acetyltransferase GCN5, Histone glutaryltransferase KAT2A, Histone succinyltransferase KAT2A, Lysine acetyltransferase 2A, STAF97, hGCN5

2 Images
Functional Studies - Recombinant human GCN5L2 protein (Active) (AB268694)
  • FuncS

Supplier Data

Functional Studies - Recombinant human GCN5L2 protein (Active) (AB268694)

The specific activity of ab268694 was 20 nmol/min/mg in a acetyltransferase assay using histone H3 peptide (1-21) as substrate.

SDS-PAGE - Recombinant human GCN5L2 protein (Active) (AB268694)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human GCN5L2 protein (Active) (AB268694)

SDS-PAGE analysis of ab268694.

Key facts

Purity

>85% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The specific activity of ab268694 was 20 nmol/min/mg in a acetyltransferase assay using histone H3 peptide (1-21) as substrate.

Accession

Q92830

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.79% Tris HCl, 0.31% Glutathione, 0.29% Sodium chloride, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":837,"aminoAcidStart":323,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":null,"tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Protein lysine acyltransferase that can act as a acetyltransferase, glutaryltransferase, succinyltransferase or malonyltransferase, depending on the context (PubMed : 29211711, PubMed : 35995428). Acts as a histone lysine succinyltransferase : catalyzes succinylation of histone H3 on 'Lys-79' (H3K79succ), with a maximum frequency around the transcription start sites of genes (PubMed : 29211711). Succinylation of histones gives a specific tag for epigenetic transcription activation (PubMed : 29211711). Association with the 2-oxoglutarate dehydrogenase complex, which provides succinyl-CoA, is required for histone succinylation (PubMed : 29211711). In different complexes, functions either as an acetyltransferase (HAT) or as a succinyltransferase : in the SAGA and ATAC complexes, acts as a histone acetyltransferase (PubMed : 17301242, PubMed : 19103755, PubMed : 29211711). Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles (PubMed : 17301242, PubMed : 19103755, PubMed : 21131905). Has a a strong preference for acetylation of H3 at 'Lys-9' (H3K9ac) (PubMed : 21131905). Acetylation of histones gives a specific tag for epigenetic transcription activation (PubMed : 17301242, PubMed : 19103755, PubMed : 29211711). Recruited by the XPC complex at promoters, where it specifically mediates acetylation of histone variant H2A.Z.1/H2A.Z, thereby promoting expression of target genes (PubMed : 29973595, PubMed : 31527837). Involved in long-term memory consolidation and synaptic plasticity : acts by promoting expression of a hippocampal gene expression network linked to neuroactive receptor signaling (By similarity). Acts as a positive regulator of T-cell activation : upon TCR stimulation, recruited to the IL2 promoter following interaction with NFATC2 and catalyzes acetylation of histone H3 at 'Lys-9' (H3K9ac), leading to promote IL2 expression (By similarity). Required for growth and differentiation of craniofacial cartilage and bone by regulating acetylation of histone H3 at 'Lys-9' (H3K9ac) (By similarity). Regulates embryonic stem cell (ESC) pluripotency and differentiation (By similarity). Also acetylates non-histone proteins, such as CEBPB, MRE11, PPARGC1A, PLK4 and TBX5 (PubMed : 16753578, PubMed : 17301242, PubMed : 27796307, PubMed : 29174768, PubMed : 38128537). Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5 (PubMed : 29174768). Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4 (PubMed : 27796307). Acts as a negative regulator of gluconeogenesis by mediating acetylation and subsequent inactivation of PPARGC1A (PubMed : 16753578, PubMed : 23142079). Also acts as a histone glutaryltransferase : catalyzes glutarylation of histone H4 on 'Lys-91' (H4K91glu), a mark that destabilizes nucleosomes by promoting dissociation of the H2A-H2B dimers from nucleosomes (PubMed : 31542297).. (Microbial infection) In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes.

Sequence similarities

Belongs to the acetyltransferase family. GCN5 subfamily.

Post-translational modifications

Acetylated at Lys-549, inhibiting the protein acetyltransferase activity (PubMed:23142079). Deacetylation at Lys-549 by SIRT6 promotes phosphorylation at Ser-307 and Thr-735 and subsequent activation of the protein acetyltransferase activity, leading to acetylation and inactivation of PPARGC1A (PubMed:23142079).

Subcellular localisation

Nucleus

Product protocols

Target data

Protein lysine acyltransferase that can act as a acetyltransferase, glutaryltransferase, succinyltransferase or malonyltransferase, depending on the context (PubMed : 29211711, PubMed : 35995428). Acts as a histone lysine succinyltransferase : catalyzes succinylation of histone H3 on 'Lys-79' (H3K79succ), with a maximum frequency around the transcription start sites of genes (PubMed : 29211711). Succinylation of histones gives a specific tag for epigenetic transcription activation (PubMed : 29211711). Association with the 2-oxoglutarate dehydrogenase complex, which provides succinyl-CoA, is required for histone succinylation (PubMed : 29211711). In different complexes, functions either as an acetyltransferase (HAT) or as a succinyltransferase : in the SAGA and ATAC complexes, acts as a histone acetyltransferase (PubMed : 17301242, PubMed : 19103755, PubMed : 29211711). Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles (PubMed : 17301242, PubMed : 19103755, PubMed : 21131905). Has a a strong preference for acetylation of H3 at 'Lys-9' (H3K9ac) (PubMed : 21131905). Acetylation of histones gives a specific tag for epigenetic transcription activation (PubMed : 17301242, PubMed : 19103755, PubMed : 29211711). Recruited by the XPC complex at promoters, where it specifically mediates acetylation of histone variant H2A.Z.1/H2A.Z, thereby promoting expression of target genes (PubMed : 29973595, PubMed : 31527837). Involved in long-term memory consolidation and synaptic plasticity : acts by promoting expression of a hippocampal gene expression network linked to neuroactive receptor signaling (By similarity). Acts as a positive regulator of T-cell activation : upon TCR stimulation, recruited to the IL2 promoter following interaction with NFATC2 and catalyzes acetylation of histone H3 at 'Lys-9' (H3K9ac), leading to promote IL2 expression (By similarity). Required for growth and differentiation of craniofacial cartilage and bone by regulating acetylation of histone H3 at 'Lys-9' (H3K9ac) (By similarity). Regulates embryonic stem cell (ESC) pluripotency and differentiation (By similarity). Also acetylates non-histone proteins, such as CEBPB, MRE11, PPARGC1A, PLK4 and TBX5 (PubMed : 16753578, PubMed : 17301242, PubMed : 27796307, PubMed : 29174768, PubMed : 38128537). Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5 (PubMed : 29174768). Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4 (PubMed : 27796307). Acts as a negative regulator of gluconeogenesis by mediating acetylation and subsequent inactivation of PPARGC1A (PubMed : 16753578, PubMed : 23142079). Also acts as a histone glutaryltransferase : catalyzes glutarylation of histone H4 on 'Lys-91' (H4K91glu), a mark that destabilizes nucleosomes by promoting dissociation of the H2A-H2B dimers from nucleosomes (PubMed : 31542297).. (Microbial infection) In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes.
See full target information KAT2A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com