JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB256014

Recombinant Human GDF15 (mutated D197H) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human GDF15 (mutated D197H) protein is a Human Fragment protein, in the 197 to 307 aa range, expressed in Escherichia coli, with >95%, <1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

MIC1, PDF, PLAB, PTGFB, GDF15, Growth/differentiation factor 15, GDF-15, Macrophage inhibitory cytokine 1, NSAID-activated gene 1 protein, NSAID-regulated gene 1 protein, Placental TGF-beta, Placental bone morphogenetic protein, Prostate differentiation factor, MIC-1, NAG-1, NRG-1

1 Images
SDS-PAGE - Recombinant Human GDF15 (mutated D197H) protein (AB256014)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human GDF15 (mutated D197H) protein (AB256014)

SDS-PAGE analysis of ab256014 (1 μg) under non-reducing (Lane 1) and reducing (Lane 2) conditions. ab256014 is a homerdimer with a predicted MW of 24.8 kDa (monomer size 12.4 kDa).

4-20% Tris-Glycine gel. Coomassie Blue staining.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q99988

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 0.1 mg/mL in water

Storage buffer

Constituents: 0.1% Trifluoroacetic acid

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MARNGDDCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC","proteinLength":"Fragment","predictedMolecularWeight":"12.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":307,"aminoAcidStart":197,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q99988","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Lyophilized

General info

Function

Hormone produced in response to various stresses to confer information about those stresses to the brain, and trigger an aversive response, characterized by nausea, vomiting, and/or loss of appetite (PubMed : 23468844, PubMed : 24971956, PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 29046435, PubMed : 30639358, PubMed : 31875646, PubMed : 33589633, PubMed : 38092039). The aversive response is both required to reduce continuing exposure to those stresses at the time of exposure and to promote avoidance behavior in the future (PubMed : 30639358, PubMed : 33589633, PubMed : 38092039). Acts by binding to its receptor, GFRAL, activating GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem (PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 31535977). It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes responses to stressful conditions (PubMed : 28953886). The GDF15-GFRAL signal induces expression of genes involved in metabolism, such as lipid metabolism in adipose tissues (PubMed : 31402172). Required for avoidance behavior in response to food allergens : induced downstream of mast cell activation to promote aversion and minimize harmful effects of exposure to noxious substances (By similarity). In addition to suppress appetite, also promotes weight loss by enhancing energy expenditure in muscle : acts by increasing calcium futile cycling in muscle (By similarity). Contributes to the effect of metformin, an anti-diabetic drug, on appetite reduction and weight loss : produced in the kidney in response to metformin treatment, thereby activating the GDF15-GFRAL response, leading to reduced appetite and weight (PubMed : 31875646, PubMed : 37060902). The contribution of GDF15 to weight loss following metformin treatment is however limited and subject to discussion (PubMed : 36001956). Produced in response to anticancer drugs, such as camptothecin or cisplatin, promoting nausea, vomiting and contributing to malnutrition (By similarity). Overproduced in many cancers, promoting anorexia in cancer (cachexia) (PubMed : 32661391). Responsible for the risk of nausea and vomiting during pregnancy : high levels of GDF15 during pregnancy, mostly originating from the fetus, are associated with increased nausea and vomiting (PubMed : 38092039). Maternal sensitivity to nausea is probably determined by pre-pregnancy exposure to GDF15, women with naturally high level of GDF15 being less susceptible to nausea than women with low levels of GDF15 before pregnancy (PubMed : 38092039). Promotes metabolic adaptation in response to systemic inflammation caused by bacterial and viral infections in order to promote tissue tolerance and prevent tissue damage (PubMed : 31402172). Required for tissue tolerance in response to myocardial infarction by acting as an inhibitor of leukocyte integring activation, thereby protecting against cardiac rupture (By similarity). Inhibits growth hormone signaling on hepatocytes (By similarity).

Sequence similarities

Belongs to the TGF-beta family.

Product protocols

Target data

Hormone produced in response to various stresses to confer information about those stresses to the brain, and trigger an aversive response, characterized by nausea, vomiting, and/or loss of appetite (PubMed : 23468844, PubMed : 24971956, PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 29046435, PubMed : 30639358, PubMed : 31875646, PubMed : 33589633, PubMed : 38092039). The aversive response is both required to reduce continuing exposure to those stresses at the time of exposure and to promote avoidance behavior in the future (PubMed : 30639358, PubMed : 33589633, PubMed : 38092039). Acts by binding to its receptor, GFRAL, activating GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem (PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 31535977). It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes responses to stressful conditions (PubMed : 28953886). The GDF15-GFRAL signal induces expression of genes involved in metabolism, such as lipid metabolism in adipose tissues (PubMed : 31402172). Required for avoidance behavior in response to food allergens : induced downstream of mast cell activation to promote aversion and minimize harmful effects of exposure to noxious substances (By similarity). In addition to suppress appetite, also promotes weight loss by enhancing energy expenditure in muscle : acts by increasing calcium futile cycling in muscle (By similarity). Contributes to the effect of metformin, an anti-diabetic drug, on appetite reduction and weight loss : produced in the kidney in response to metformin treatment, thereby activating the GDF15-GFRAL response, leading to reduced appetite and weight (PubMed : 31875646, PubMed : 37060902). The contribution of GDF15 to weight loss following metformin treatment is however limited and subject to discussion (PubMed : 36001956). Produced in response to anticancer drugs, such as camptothecin or cisplatin, promoting nausea, vomiting and contributing to malnutrition (By similarity). Overproduced in many cancers, promoting anorexia in cancer (cachexia) (PubMed : 32661391). Responsible for the risk of nausea and vomiting during pregnancy : high levels of GDF15 during pregnancy, mostly originating from the fetus, are associated with increased nausea and vomiting (PubMed : 38092039). Maternal sensitivity to nausea is probably determined by pre-pregnancy exposure to GDF15, women with naturally high level of GDF15 being less susceptible to nausea than women with low levels of GDF15 before pregnancy (PubMed : 38092039). Promotes metabolic adaptation in response to systemic inflammation caused by bacterial and viral infections in order to promote tissue tolerance and prevent tissue damage (PubMed : 31402172). Required for tissue tolerance in response to myocardial infarction by acting as an inhibitor of leukocyte integring activation, thereby protecting against cardiac rupture (By similarity). Inhibits growth hormone signaling on hepatocytes (By similarity).
See full target information GDF15 mutated D197H

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com