JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB50077

Recombinant human GDF15 protein

Be the first to review this product! Submit a review

|

(3 Publications)

Recombinant human GDF15 protein is a Human Full Length protein, in the 197 to 308 aa range, expressed in CHO cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

MIC1, PDF, PLAB, PTGFB, GDF15, Growth/differentiation factor 15, GDF-15, Macrophage inhibitory cytokine 1, NSAID-activated gene 1 protein, NSAID-regulated gene 1 protein, Placental TGF-beta, Placental bone morphogenetic protein, Prostate differentiation factor, MIC-1, NAG-1, NRG-1

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

CHO cells

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Determined by its ability to inhibit alkaline phosphatase activity in differentiating MC3T3/E1 osetoblast cells. The expected ED50 for this effect is 75-200 ng/ml.

Accession

Q99988

Animal free

No

Carrier free

No

Species

Human

Reconstitution

reconstitute with water at 1mg/mL

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Molecular Weight: 24.6 kDa

Sequence info

[{"sequence":"ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI","proteinLength":"Full Length","predictedMolecularWeight":"24.6 kDa","actualMolecularWeight":"24.6 kDa","aminoAcidEnd":308,"aminoAcidStart":197,"nature":"Recombinant","expressionSystem":"CHO cells","accessionNumber":"Q99988","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
A few weeks
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
True

Specifications

Form

Lyophilized

Additional notes

ab50077 purity was determined also by HPLC

General info

Function

Hormone produced in response to various stresses to confer information about those stresses to the brain, and trigger an aversive response, characterized by nausea, vomiting, and/or loss of appetite (PubMed : 23468844, PubMed : 24971956, PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 29046435, PubMed : 30639358, PubMed : 31875646, PubMed : 33589633, PubMed : 38092039). The aversive response is both required to reduce continuing exposure to those stresses at the time of exposure and to promote avoidance behavior in the future (PubMed : 30639358, PubMed : 33589633, PubMed : 38092039). Acts by binding to its receptor, GFRAL, activating GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem (PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 31535977). It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes responses to stressful conditions (PubMed : 28953886). The GDF15-GFRAL signal induces expression of genes involved in metabolism, such as lipid metabolism in adipose tissues (PubMed : 31402172). Required for avoidance behavior in response to food allergens : induced downstream of mast cell activation to promote aversion and minimize harmful effects of exposure to noxious substances (By similarity). In addition to suppress appetite, also promotes weight loss by enhancing energy expenditure in muscle : acts by increasing calcium futile cycling in muscle (By similarity). Contributes to the effect of metformin, an anti-diabetic drug, on appetite reduction and weight loss : produced in the kidney in response to metformin treatment, thereby activating the GDF15-GFRAL response, leading to reduced appetite and weight (PubMed : 31875646, PubMed : 37060902). The contribution of GDF15 to weight loss following metformin treatment is however limited and subject to discussion (PubMed : 36001956). Produced in response to anticancer drugs, such as camptothecin or cisplatin, promoting nausea, vomiting and contributing to malnutrition (By similarity). Overproduced in many cancers, promoting anorexia in cancer (cachexia) (PubMed : 32661391). Responsible for the risk of nausea and vomiting during pregnancy : high levels of GDF15 during pregnancy, mostly originating from the fetus, are associated with increased nausea and vomiting (PubMed : 38092039). Maternal sensitivity to nausea is probably determined by pre-pregnancy exposure to GDF15, women with naturally high level of GDF15 being less susceptible to nausea than women with low levels of GDF15 before pregnancy (PubMed : 38092039). Promotes metabolic adaptation in response to systemic inflammation caused by bacterial and viral infections in order to promote tissue tolerance and prevent tissue damage (PubMed : 31402172). Required for tissue tolerance in response to myocardial infarction by acting as an inhibitor of leukocyte integring activation, thereby protecting against cardiac rupture (By similarity). Inhibits growth hormone signaling on hepatocytes (By similarity).

Sequence similarities

Belongs to the TGF-beta family.

Product protocols

Target data

Hormone produced in response to various stresses to confer information about those stresses to the brain, and trigger an aversive response, characterized by nausea, vomiting, and/or loss of appetite (PubMed : 23468844, PubMed : 24971956, PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 29046435, PubMed : 30639358, PubMed : 31875646, PubMed : 33589633, PubMed : 38092039). The aversive response is both required to reduce continuing exposure to those stresses at the time of exposure and to promote avoidance behavior in the future (PubMed : 30639358, PubMed : 33589633, PubMed : 38092039). Acts by binding to its receptor, GFRAL, activating GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem (PubMed : 28846097, PubMed : 28846098, PubMed : 28846099, PubMed : 28953886, PubMed : 31535977). It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes responses to stressful conditions (PubMed : 28953886). The GDF15-GFRAL signal induces expression of genes involved in metabolism, such as lipid metabolism in adipose tissues (PubMed : 31402172). Required for avoidance behavior in response to food allergens : induced downstream of mast cell activation to promote aversion and minimize harmful effects of exposure to noxious substances (By similarity). In addition to suppress appetite, also promotes weight loss by enhancing energy expenditure in muscle : acts by increasing calcium futile cycling in muscle (By similarity). Contributes to the effect of metformin, an anti-diabetic drug, on appetite reduction and weight loss : produced in the kidney in response to metformin treatment, thereby activating the GDF15-GFRAL response, leading to reduced appetite and weight (PubMed : 31875646, PubMed : 37060902). The contribution of GDF15 to weight loss following metformin treatment is however limited and subject to discussion (PubMed : 36001956). Produced in response to anticancer drugs, such as camptothecin or cisplatin, promoting nausea, vomiting and contributing to malnutrition (By similarity). Overproduced in many cancers, promoting anorexia in cancer (cachexia) (PubMed : 32661391). Responsible for the risk of nausea and vomiting during pregnancy : high levels of GDF15 during pregnancy, mostly originating from the fetus, are associated with increased nausea and vomiting (PubMed : 38092039). Maternal sensitivity to nausea is probably determined by pre-pregnancy exposure to GDF15, women with naturally high level of GDF15 being less susceptible to nausea than women with low levels of GDF15 before pregnancy (PubMed : 38092039). Promotes metabolic adaptation in response to systemic inflammation caused by bacterial and viral infections in order to promote tissue tolerance and prevent tissue damage (PubMed : 31402172). Required for tissue tolerance in response to myocardial infarction by acting as an inhibitor of leukocyte integring activation, thereby protecting against cardiac rupture (By similarity). Inhibits growth hormone signaling on hepatocytes (By similarity).
See full target information GDF15

Publications (3)

Recent publications for all applications. Explore the full list and refine your search

Frontiers in pharmacology 13:849014 PubMed36120344

2022

Artemisinin analog SM934 alleviates epithelial barrier dysfunction inhibiting apoptosis and caspase-1-mediated pyroptosis in experimental colitis.

Applications

Unspecified application

Species

Unspecified reactive species

Meijuan Shao,Yuxi Yan,Fenghua Zhu,Xiaoqian Yang,Qing Qi,Fangming Yang,Tingting Hao,Zemin Lin,Peilan He,Yu Zhou,Wei Tang,Shijun He,Jianping Zuo

JCI insight 7: PubMed35993367

2022

Increased expression and accumulation of GDF15 in IPF extracellular matrix contribute to fibrosis.

Applications

Unspecified application

Species

Unspecified reactive species

Agata Radwanska,Christopher Travis Cottage,Antonio Piras,Catherine Overed-Sayer,Carina Sihlbom,Ramachandramouli Budida,Catherine Wrench,Jane Connor,Susan Monkley,Petra Hazon,Holger Schluter,Matthew J Thomas,Cory M Hogaboam,Lynne A Murray

Cell biochemistry and function 38:1089-1099 PubMed32638404

2020

LINC-PINT suppresses tumour cell proliferation, migration and invasion through targeting miR-374a-5p in ovarian cancer.

Applications

Unspecified application

Species

Unspecified reactive species

Ting Hao,Shu Huang,Fangzheng Han
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com