JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB140556

Recombinant Human Gemin6/SIP2 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Gemin6/SIP2 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 167 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Gem-associated protein 6, Gemin-6, SIP2, GEMIN6

1 Images
SDS-PAGE - Recombinant Human Gemin6/SIP2 protein (His tag N-Terminus) (AB140556)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Gemin6/SIP2 protein (His tag N-Terminus) (AB140556)

15% SDS-PAGE analysis of ab140556 (3μg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q8WXD5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as Gemin 6.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ","proteinLength":"Full Length","predictedMolecularWeight":"21.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":167,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8WXD5","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Gemin6 also known as SIP2 (Survival of Motor Neurons Interacting Protein 2) is a protein that plays a role in the assembly of small nuclear ribonucleoproteins (snRNPs). It has a molecular weight of approximately 39 kDa and is expressed mainly in the brain and spinal cord. This protein facilitates interactions within the SMN (Survival Motor Neuron) complex which is essential for the biogenesis of snRNPs necessary for pre-mRNA splicing.
Biological function summary

Gemin6/SIP2 functions as a component of the SMN complex which is key to snRNP maturation and assembly. The SMN complex plays an important role in the cellular machinery responsible for processing pre-mRNA to mature mRNA. Gemin6/SIP2 binds specifically to core proteins in snRNPs aiding in their stability and function. It ensures accurate splicing of mRNA which is critical for proper gene expression and cellular function.

Pathways

Several molecules are associated with the Gemin6/SIP2's role in spliceosomal snRNP assembly. It is involved in the pre-mRNA splicing pathway and links to the RNA transport pathway via the SMN complex. Proteins such as Gemin2 and Sm proteins relate closely to Gemin6/SIP2 through these pathways forming a functional network critical for RNA processing and regulation.

Gemin6/SIP2 has connections to neurodegenerative conditions such as spinal muscular atrophy (SMA). SMA is characterized by the loss of motor neurons which Gemin6/SIP2 influences through its function in the SMN complex. The dysfunction of this complex due to mutations or imbalances can contribute to the symptoms of SMA. Gemin6/SIP2 connects with SMN protein whose deficiency directly associates with the pathogenesis of SMA highlighting the significance of this protein in neurological health.

Specifications

Form

Liquid

Additional notes

ab140556 was purified using conventional chromatography.

General info

Function

The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A forming an intermediate. Binding of snRNA inside 5Sm triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP.

Subcellular localisation

Nucleus

Product protocols

Target data

The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A forming an intermediate. Binding of snRNA inside 5Sm triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP.
See full target information GEMIN6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com