JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB134622

Recombinant Human GILT protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human GILT protein is a Human Full Length protein, in the 58 to 232 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

GILT, IP30, IFI30, Gamma-interferon-inducible lysosomal thiol reductase, Gamma-interferon-inducible protein IP-30, Legumaturain

1 Images
SDS-PAGE - Recombinant Human GILT protein (AB134622)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human GILT protein (AB134622)

15% SDS-PAGE analysis of 3 μg ab134622.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P13284

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as IFI30

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK","proteinLength":"Full Length","predictedMolecularWeight":"22.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":232,"aminoAcidStart":58,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P13284","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Gamma-interferon-inducible lysosomal thiol reductase often called GILT is a thiol reductase enzyme with a mass of about 35 kDa. GILT is expressed predominantly in antigen-presenting cells where it resides in the lysosomes. Mechanically GILT catalyzes the reduction of disulfide bonds in proteins which enables proteins to unfold under mild acidic conditions found in lysosomal compartments. GILT activity requires the catalytic cysteine residue which is essential for its function as a reductase.
Biological function summary

GILT contributes to the processing and presentation of antigens. By reducing disulfide bonds in endocytosed proteins GILT prepares them for subsequent degradation by lysosomal proteases. This function means it plays a significant role in the immune response as it aids the generation of peptides presented on major histocompatibility complex (MHC) class II molecules. GILT is not known to be part of a larger protein complex but interacts with other components within the lysosome to accomplish its task.

Pathways

GILT is integral to the antigen processing and presentation pathway mediated by MHC class II molecules. This pathway is critical for the initiation of immune responses and involves collaboration with other proteins such as cathepsins. The reduction of disulfide bonds by GILT allows cathepsins to efficiently degrade proteins into peptide fragments. These peptides then bind to MHC class II molecules which are presented on the cell surface for recognition by CD4+ T cells.

Altered GILT function has been linked to autoimmune diseases and cancer. In certain autoimmune disorders dysregulation of GILT can lead to improper antigen presentation contributing to the body's immune response against its own tissues. In cancer some tumors may downregulate GILT to escape immune surveillance by reducing antigen presentation. Interactions between GILT and other proteins such as MHC class II facilitate these pathological processes highlighting the importance of GILT in maintaining immune system balance.

Specifications

Form

Liquid

Additional notes

ab134622 is purified by conventional column chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.

General info

Function

Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds (By similarity). Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation (By similarity).

Sequence similarities

Belongs to the GILT family.

Post-translational modifications

N-glycosylated. Sugar chains contain mannose-6-phosphate.. Synthesized as a 35 kDa precursor which is then processed into the mature 30 kDa form via cleavage of N-terminal and C-terminal propeptides. Processing of the precursor is mediated by multiple lysosomal proteases.

Subcellular localisation

Lysosome

Product protocols

Target data

Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds (By similarity). Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation (By similarity).
See full target information IFI30

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com