JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235719

Recombinant Human Oxyntomodulin (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Oxyntomodulin (GST tag N-Terminus) is a Human Fragment protein, in the 53 to 89 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.
1 Images
SDS-PAGE - Recombinant Human Oxyntomodulin (GST tag N-Terminus) (AB235719)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Oxyntomodulin (GST tag N-Terminus) (AB235719)

(Tris-glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab235719.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P01275-1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA","proteinLength":"Fragment","predictedMolecularWeight":"30.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":89,"aminoAcidStart":53,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01275","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Liquid
Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

General info

Function

Glucagon. Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Binds to and activates the glucagon receptor GCGR, which couples to the G(s) G protein and elevates intracellular cAMP, triggering downstream metabolic responses (PubMed : 32193322).. Glucagon-like peptide 1. Potent stimulator of glucose-dependent insulin release (PubMed : 22037645, PubMed : 40446798). Also stimulates insulin release in response to IL6 (PubMed : 22037645). Plays important roles on gastric motility and the suppression of plasma glucagon levels (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Has growth-promoting activities on intestinal epithelium (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Inhibits beta cell apoptosis (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744).. Glucagon-like peptide 2. Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.. Oxyntomodulin. Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.. Glicentin. May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.

Sequence similarities

Belongs to the glucagon family.

Post-translational modifications

Proglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by post-translational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas.

Product protocols

Target data

Glucagon. Plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Binds to and activates the glucagon receptor GCGR, which couples to the G(s) G protein and elevates intracellular cAMP, triggering downstream metabolic responses (PubMed : 32193322).. Glucagon-like peptide 1. Potent stimulator of glucose-dependent insulin release (PubMed : 22037645, PubMed : 40446798). Also stimulates insulin release in response to IL6 (PubMed : 22037645). Plays important roles on gastric motility and the suppression of plasma glucagon levels (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Has growth-promoting activities on intestinal epithelium (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744). Inhibits beta cell apoptosis (PubMed : 10605628, PubMed : 14719035, PubMed : 12554744).. Glucagon-like peptide 2. Stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.. Oxyntomodulin. Significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.. Glicentin. May modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.
See full target information Oxyntomodulin

Alternative Names

Pro-glucagon

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com