JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114484

Recombinant Human Glypican 1/ GPC1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Glypican 1/ GPC1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 24 to 131 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Glypican-1, GPC1

1 Images
SDS-PAGE - Recombinant Human Glypican 1/ GPC1 protein (GST tag N-Terminus) (AB114484)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Glypican 1/ GPC1 protein (GST tag N-Terminus) (AB114484)

12.5% SDS-PAGE showing ab114484 at approximately 37.51kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

P35052

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Sequence info

[{"sequence":"DPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFG","proteinLength":"Fragment","predictedMolecularWeight":"37.51 kDa","actualMolecularWeight":null,"aminoAcidEnd":131,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P35052","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Glypican 1 (GPC1) also known as glypican-1 is a heparan sulfate proteoglycan anchored to the cell membrane via a glycosylphosphatidylinositol (GPI) anchor. This protein belongs to the glypican family and has an approximate mass of 60 to 70 kDa. GPC1 is found mainly on the surface of cells in the central nervous system as well as in muscle tissues and certain epithelial cells. Its structure facilitates interaction with cell surface receptors and extracellular matrix components playing an important role in cellular communication and signaling processes.
Biological function summary

GPC1 influences the regulation of growth factors and morphogens and it has a significant role in the cell division and growth processes. It is not recognized as part of any larger protein complex but interacts with diverse ligand molecules. Researchers identify GPC1 as an important facilitator of fibroblast growth factors (FGF) and sonic hedgehog (Shh) signaling. Its interaction with molecular partners helps to regulate developmental signals important for proper cellular function and organ development.

Pathways

The contributions of GPC1 are observed in the hedgehog signaling pathway and fibroblast growth factor signaling. GPC1's interaction within the hedgehog pathway is critical for organizing cellular growth and differentiation while its involvement in the FGF pathway supports angiogenesis and wound healing. GPC1 coordinates with other glypican family members and related proteins like FGFR1 to mediate these signaling processes effectively.

Researchers have linked GPC1 with cancer progression and neurodegenerative diseases. Abnormal GPC1 expression is often noted in pancreatic cancer influencing tumor growth and metastasis through its modulation of growth factor signaling. Moreover its role in neurodegenerative conditions such as Alzheimer's disease establishes connections with amyloid-beta peptides and tau proteins contributing to disease pathogenesis. These associations make GPC1 an intriguing target for therapeutic intervention and a focus for ongoing medical research.

Specifications

Form

Liquid

General info

Function

Cell surface proteoglycan that bears heparan sulfate. Binds, via the heparan sulfate side chains, alpha-4 (V) collagen and participates in Schwann cell myelination (By similarity). May act as a catalyst in increasing the rate of conversion of prion protein PRPN(C) to PRNP(Sc) via associating (via the heparan sulfate side chains) with both forms of PRPN, targeting them to lipid rafts and facilitating their interaction. Required for proper skeletal muscle differentiation by sequestering FGF2 in lipid rafts preventing its binding to receptors (FGFRs) and inhibiting the FGF-mediated signaling.

Sequence similarities

Belongs to the glypican family.

Post-translational modifications

S-nitrosylated in a Cu(2+)-dependent manner. Nitric acid (NO) is released from the nitrosylated cysteines by ascorbate or by some other reducing agent, in a Cu(2+) or Zn(2+) dependent manner. This free nitric oxide is then capable of cleaving the heparan sulfate side chains.. N- and O-glycosylated. N-glycosylation is mainly of the complex type containing sialic acid. O-glycosylated with heparan sulfate. The heparan sulfate chains can be cleaved either by the action of heparanase or, degraded by a deaminative process that uses nitric oxide (NO) released from the S-nitrosylated cysteines. This process is triggered by ascorbate, or by some other reducing agent, in a Cu(2+)- or Zn(2+) dependent manner. Cu(2+) ions are provided by ceruloproteins such as APP, PRNP or CP which associate with GCP1 in intracellular compartments or lipid rafts.. This cell-associated glypican is further processed to give rise to a medium-released species.

Subcellular localisation

Endosome

Product protocols

Target data

Cell surface proteoglycan that bears heparan sulfate. Binds, via the heparan sulfate side chains, alpha-4 (V) collagen and participates in Schwann cell myelination (By similarity). May act as a catalyst in increasing the rate of conversion of prion protein PRPN(C) to PRNP(Sc) via associating (via the heparan sulfate side chains) with both forms of PRPN, targeting them to lipid rafts and facilitating their interaction. Required for proper skeletal muscle differentiation by sequestering FGF2 in lipid rafts preventing its binding to receptors (FGFRs) and inhibiting the FGF-mediated signaling.
See full target information GPC1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com