JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316055

Recombinant Human GPC3 VLP (Active) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human GPC3 VLP (Active) protein is a Human Fragment protein, in the 438 to 554 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for FuncS.

View Alternative Names

OCI5, GPC3, Glypican-3, GTR2-2, Intestinal protein OCI-5, MXR7

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS

applications

Biologically active

Yes

Biological activity

Immobilized Human GPC3 (438-554) VLP at 5ug/ml (100ul/Well) on the plate. Dose response curve for Anti-GPC3 Antibody, hFc Tag with the EC50 of 24.1ng/ml determined by ELISA.

Accession

P51654

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHN","proteinLength":"Fragment","predictedMolecularWeight":"21.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":554,"aminoAcidStart":438,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P51654","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Glypican 3 also known as GPC3 is a cell surface heparan sulfate proteoglycan with a core protein mass of approximately 70 kDa. This target is anchored to the external cell membrane through a glycosylphosphatidylinositol (GPI) anchor. Glypican 3 is expressed mainly in tissues such as the liver and kidneys and plays a role in modulating cell growth and development. In research studies it is often studied in various species including in the mouse and cynomolgus monkey models where it's referred to as mouse glypican 3 and cynomolgus glypican 3 respectively.
Biological function summary

Glypican 3 is involved in the modulation of signaling pathways that control cell proliferation and differentiation. It does not function as an isolated element; it has a role as part of a complex network that interacts with growth factors morphogens and other proteoglycans. Glypican 3 assists in the regulation of important biological events by influencing the accessibility and activity of signaling molecules on the cell surface. Its heparan sulfate chains interact with multiple proteins modifying their function and availability.

Pathways

Glypican 3 plays a significant part in the Wnt and Hedgehog signaling pathways. In the Wnt pathway it regulates the distribution and gradient formation of Wnt proteins which are essential for proper embryonic development. In the Hedgehog pathway glypican 3 modulates the distribution and activity of Hedgehog proteins important for tissue patterning and organogenesis. Other proteins closely related to glypican 3 in these pathways include those from the frizzled family in the Wnt pathway and Patched proteins in the Hedgehog pathway.

Glypican 3 has a strong connection to hepatocellular carcinoma (HCC) and Simpson-Golabi-Behmel syndrome (SGBS). In HCC increased expression of glypican 3 is often observed which associates it with tumor growth and proliferation. It functions alongside other oncogenic factors like alpha-fetoprotein (AFP) which is another marker for liver cancer. In SGBS mutations in the GPC3 gene result in defects in cellular signaling pathways leading to developmental abnormalities. This syndrome highlights the impact of glypican 3 on growth regulation and its interactions with insulin-like growth factors (IGFs).

Specifications

Form

Liquid

General info

Function

Cell surface proteoglycan (PubMed : 14610063). Negatively regulates the hedgehog signaling pathway when attached via the GPI-anchor to the cell surface by competing with the hedgehog receptor PTC1 for binding to hedgehog proteins (By similarity). Binding to the hedgehog protein SHH triggers internalization of the complex by endocytosis and its subsequent lysosomal degradation (By similarity). Positively regulates the canonical Wnt signaling pathway by binding to the Wnt receptor Frizzled and stimulating the binding of the Frizzled receptor to Wnt ligands (PubMed : 16227623, PubMed : 24496449). Positively regulates the non-canonical Wnt signaling pathway (By similarity). Binds to CD81 which decreases the availability of free CD81 for binding to the transcriptional repressor HHEX, resulting in nuclear translocation of HHEX and transcriptional repression (By similarity). Inhibits the dipeptidyl peptidase activity of DPP4 (PubMed : 17549790). Plays a role in limb patterning and skeletal development by controlling the cellular response to BMP4 (By similarity). Modulates the effects of growth factors BMP2, BMP7 and FGF7 on renal branching morphogenesis (By similarity). Required for coronary vascular development (By similarity). Plays a role in regulating cell movements during gastrulation (By similarity).

Sequence similarities

Belongs to the glypican family.

Post-translational modifications

O-glycosylated; contains heparan sulfate and/or chondroitin sulfate.. Cleaved intracellularly by a furin-like convertase to generate 2 subunits, alpha and beta, which remain associated through disulfide bonds and are associated with the cell surface via the GPI-anchor (PubMed:14610063). This processing is essential for its role in inhibition of hedgehog signaling (PubMed:25653284). A second proteolytic event may result in cleavage of the protein on the cell surface, separating it from the GPI-anchor and leading to its shedding from the cell surface (PubMed:14610063).

Product protocols

Target data

Cell surface proteoglycan (PubMed : 14610063). Negatively regulates the hedgehog signaling pathway when attached via the GPI-anchor to the cell surface by competing with the hedgehog receptor PTC1 for binding to hedgehog proteins (By similarity). Binding to the hedgehog protein SHH triggers internalization of the complex by endocytosis and its subsequent lysosomal degradation (By similarity). Positively regulates the canonical Wnt signaling pathway by binding to the Wnt receptor Frizzled and stimulating the binding of the Frizzled receptor to Wnt ligands (PubMed : 16227623, PubMed : 24496449). Positively regulates the non-canonical Wnt signaling pathway (By similarity). Binds to CD81 which decreases the availability of free CD81 for binding to the transcriptional repressor HHEX, resulting in nuclear translocation of HHEX and transcriptional repression (By similarity). Inhibits the dipeptidyl peptidase activity of DPP4 (PubMed : 17549790). Plays a role in limb patterning and skeletal development by controlling the cellular response to BMP4 (By similarity). Modulates the effects of growth factors BMP2, BMP7 and FGF7 on renal branching morphogenesis (By similarity). Required for coronary vascular development (By similarity). Plays a role in regulating cell movements during gastrulation (By similarity).
See full target information GPC3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com