JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB314525

Recombinant human GPCR GPR35 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human GPCR GPR35 protein (His tag) is a Human Full Length protein, in the 1 to 309 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

G-protein coupled receptor 35, Kynurenic acid receptor, KYNA receptor, GPR35

1 Images
SDS-PAGE - Recombinant human GPCR GPR35 protein (His tag) (AB314525)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human GPCR GPR35 protein (His tag) (AB314525)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9HC97

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in water

Storage buffer

pH: 7.4 - 8 Constituents: 6% Trehalose, 0.87% Sodium chloride, 0.24% Tris, 0.05% 2-Octadecoxyethanol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20degC/-80degC. Our default final concentration of glycerol is 50%.

Sequence info

[{"sequence":"MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA","proteinLength":"Full Length","predictedMolecularWeight":"36.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":309,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9HC97","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C|-80°C
Appropriate long-term storage conditions
-20°C|-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

GPCR GPR62 also known simply as GPR62 is a G protein-coupled receptor. It is a member of a larger family of receptors that possess seven transmembrane domains and are involved in signal transduction processes. GPR62 has an estimated mass of about 36 kDa. It expresses primarily in the brain specifically in regions associated with cognitive and emotional functions such as the cerebral cortex and hippocampus. Studies continue to investigate the precise expression patterns to better understand its role.
Biological function summary

GPR62 participates in cellular signaling by interacting with G proteins to transmit signals inside the cell. Although not well-characterized compared to other GPCRs evidence suggests GPR62 may play a role in modulating neurotransmitter release and brain activity. It does not belong to a known receptor complex but its actions presumably influence neurological pathways related to cognition and mood regulation.

Pathways

Studies indicate GPR62 engages primarily with signaling cascades involved in neuronal communication and response. While its exact pathways are not fully documented links suggest it could affect pathways like the cAMP signaling pathway. GPR62 shares relationships with various neurotransmitter systems and could exhibit interactions with GPR35 and other neuroreceptor partners in these pathways influencing cognitive processes.

GPR62's expression patterns and pathway involvement suggest a potential link to psychiatric conditions such as depression or anxiety disorders. Dysfunctional signaling or altered expression of GPR62 might affect mood regulation contributing to these disorders. Additionally its interactions within the brain connect GPR62 with proteins implicated in neurodegeneration though definitive links require further exploration to identify specific connections and mechanisms.

Specifications

Form

Lyophilized

General info

Function

G-protein coupled receptor that binds to several ligands including the tryptophan metabolite kynurenic acid (KYNA), lysophosphatidic acid (LPA) or 5-hydroxyindoleacetic acid (5-HIAA) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways (PubMed : 16754668, PubMed : 19473985, PubMed : 20361937, PubMed : 24347166, PubMed : 35148838, PubMed : 35926043). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors, such as adenylate cyclase (PubMed : 19473985, PubMed : 35926043). GPR35 can couple with G(i)/G(o)- or G(12)/G(13) classes of G alpha proteins depending on the context, mediating the inhibition of adenylate cyclase or activation Rho small GTPases, respectively (PubMed : 19473985, PubMed : 35926043, PubMed : 36543774). KYNA-binding promotes monocyte adhesion to vascular endothelium under flow conditions, leading to G(i)/GNAI1 activation and inhibition of adenylate cyclase (PubMed : 19473985). Involved in cardioprotection during ischemia by promoting mitochondrial remodeling : following KYNA-binding and G(i)/GNAI1 activation, GPR35 is internalized to the outer mitochondrial membrane, where it inhibits mitochondrial adenylate cyclase (ADCY10), allowing ATPIF1 to repress ATP synthase activity (PubMed : 35926043). Stimulates lipid metabolism, thermogenic and anti-inflammatory gene expression in adipose tissue once activated by KYNA (By similarity). Plays a role in neutrophil recruitment to sites of inflammation and bacterial clearance through the major serotonin metabolite 5-HIAA that acts as a physiological ligand (PubMed : 35148838). In macrophages, activation by lysophosphatidic acid promotes GPR35-induced signaling with a distinct transcriptional profile characterized by TNF production associated with ERK and NF-kappa-B activation (By similarity). In turn, induces chemotaxis of macrophages (By similarity).

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

Multiply phosphorylated in clusters of serines and threonines in the C-terminal tail (PubMed:35101446). Phosphorylation of Ser-300 and Ser-303 is mediated by GRK5 and/or GRK6 (PubMed:37660910).

Product protocols

Target data

G-protein coupled receptor that binds to several ligands including the tryptophan metabolite kynurenic acid (KYNA), lysophosphatidic acid (LPA) or 5-hydroxyindoleacetic acid (5-HIAA) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways (PubMed : 16754668, PubMed : 19473985, PubMed : 20361937, PubMed : 24347166, PubMed : 35148838, PubMed : 35926043). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors, such as adenylate cyclase (PubMed : 19473985, PubMed : 35926043). GPR35 can couple with G(i)/G(o)- or G(12)/G(13) classes of G alpha proteins depending on the context, mediating the inhibition of adenylate cyclase or activation Rho small GTPases, respectively (PubMed : 19473985, PubMed : 35926043, PubMed : 36543774). KYNA-binding promotes monocyte adhesion to vascular endothelium under flow conditions, leading to G(i)/GNAI1 activation and inhibition of adenylate cyclase (PubMed : 19473985). Involved in cardioprotection during ischemia by promoting mitochondrial remodeling : following KYNA-binding and G(i)/GNAI1 activation, GPR35 is internalized to the outer mitochondrial membrane, where it inhibits mitochondrial adenylate cyclase (ADCY10), allowing ATPIF1 to repress ATP synthase activity (PubMed : 35926043). Stimulates lipid metabolism, thermogenic and anti-inflammatory gene expression in adipose tissue once activated by KYNA (By similarity). Plays a role in neutrophil recruitment to sites of inflammation and bacterial clearance through the major serotonin metabolite 5-HIAA that acts as a physiological ligand (PubMed : 35148838). In macrophages, activation by lysophosphatidic acid promotes GPR35-induced signaling with a distinct transcriptional profile characterized by TNF production associated with ERK and NF-kappa-B activation (By similarity). In turn, induces chemotaxis of macrophages (By similarity).
See full target information GPR35

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com