JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB314619

Recombinant Human GPR15 Protein (His Tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human GPR15 Protein (His Tag) is a Human Full Length protein, in the 1 to 360 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

G-protein coupled receptor 15, Brother of Bonzo, BoB, GPR15

1 Images
SDS-PAGE - Recombinant Human GPR15 Protein (His Tag) (AB314619)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human GPR15 Protein (His Tag) (AB314619)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. It is speculated that the protein forms a dimeric structure. Observed band size : Monomer:42 kDa Dimer:84 kDa

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

10x His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P49685

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Storage buffer

pH: 7.4 - 8 Constituents: 6% Trehalose, 0.87% Sodium chloride, 0.24% Tris, 0.05% dodecyl 2-(trimethylazaniumyl)ethyl phosphate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL","proteinLength":"Full Length","predictedMolecularWeight":"43.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":360,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P49685","tags":[{"tag":"10x His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Add glycerol to a final volume of 50% for extra stability and aliquot
Storage information
The product can be stored for up to 12 months
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

GPR15 also known as G protein-coupled receptor 15 is a receptor involved in cell signaling. It has a molecular mass of approximately 41 kDa. This receptor is expressed mainly in intestinal tissues but also appears in a variety of immune cells including certain T-cells. GPR15 participates in chemokine signaling processes by binding extracellular ligands and mediating signals inside the cell through interaction with G proteins which then trigger downstream pathways.
Biological function summary

G protein-coupled receptor 15 regulates immune responses and contributes to maintaining the integrity of the intestinal epithelial barrier. It serves as a homing receptor guiding the migration of T-cells to specific tissues especially in the gut. This function is critical for both gut immune homeostasis and inflammatory responses. Although part of the larger G protein-coupled receptor complex family it operates mainly as an individual entity orchestrating responses to environmental signals.

Pathways

Signals initiated by G protein-coupled receptor 15 affect the MAPK/ERK pathway which plays a pivotal role in cell division differentiation and survival. These pathways connect GPR15 functionally to various proteins such as Ras and Raf which are also central to the path regulation. Additionally this receptor is involved in the modulation of cytokine signaling pathways influencing immune and inflammatory responses through interaction with cytokines and chemokines in its vicinity.

G protein-coupled receptor 15 has relevance to inflammatory bowel disease and HIV infection. Its involvement in immune cell homing to the gut links it to the pathology of inflammatory bowel diseases where it may exacerbate inflammation by recruiting effector T-cells. In HIV infection the virus exploits GPR15 alongside the protein CCR5 to enter target cells making this receptor a potential target for therapeutic intervention in managing the infection. Understanding GPR15's roles improves insight into both immune-related disorders and infectious disease pathways.

Specifications

Form

Lyophilized

General info

Function

G protein-coupled receptor that plays an important role in immune homeostasis (PubMed : 33758080, PubMed : 38918398). Acts via its natural ligand GPR15LG, a chemokine-like polypeptide strongly expressed in gastrointestinal tissues. GPR15-GPR15LG signaling axis regulates intestinal homeostasis and inflammation through the migration of immune cells (PubMed : 33758080, PubMed : 38918398). Controls thereby the specific homing of T-cells, particularly FOXP3+ regulatory T-cells (Tregs), to the large intestine lamina propria (By similarity). Also required for skin localization of thymus-derived dendritic epidermal T-cells (By similarity). Plays an important role in mediating cytoprotective function as well as angiogenesis of thrombomodulin (By similarity). Mechanistically, preferentially signals through the Gi/o pathway to inhibit adenylate cyclase activity and activate a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores (PubMed : 35510660).. (Microbial infection) Acts as an alternative coreceptor with CD4 for HIV-1 infection.

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

Phosphorylation is necessary for YWHAE binding and efficient surface expression.. O-glycosylated (PubMed:21189250). Sialylated O-glycans in the N-terminal tail inhibits binding of GPR15LG (PubMed:33758080).. Sulfation is required for efficient binding of GPR15LG.

Product protocols

Target data

G protein-coupled receptor that plays an important role in immune homeostasis (PubMed : 33758080, PubMed : 38918398). Acts via its natural ligand GPR15LG, a chemokine-like polypeptide strongly expressed in gastrointestinal tissues. GPR15-GPR15LG signaling axis regulates intestinal homeostasis and inflammation through the migration of immune cells (PubMed : 33758080, PubMed : 38918398). Controls thereby the specific homing of T-cells, particularly FOXP3+ regulatory T-cells (Tregs), to the large intestine lamina propria (By similarity). Also required for skin localization of thymus-derived dendritic epidermal T-cells (By similarity). Plays an important role in mediating cytoprotective function as well as angiogenesis of thrombomodulin (By similarity). Mechanistically, preferentially signals through the Gi/o pathway to inhibit adenylate cyclase activity and activate a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores (PubMed : 35510660).. (Microbial infection) Acts as an alternative coreceptor with CD4 for HIV-1 infection.
See full target information GPR15

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com