JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB162701

Recombinant Human GPR84 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human GPR84 protein is a Human Fragment protein, in the 208 to 316 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

EX33, GPR84, G-protein coupled receptor 84, Inflammation-related G-protein coupled receptor EX33

1 Images
SDS-PAGE - Recombinant Human GPR84 protein (AB162701)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human GPR84 protein (AB162701)

ab162701 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q9NQS5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":316,"aminoAcidStart":208,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9NQS5","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

GPR84 also known as EX33 or GPCR4 is a G protein-coupled receptor with a molecular mass of approximately 41 kDa. It is expressed mainly in the immune system including neutrophils macrophages and microglia. Researchers have also found it in significant amounts in lymphoid tissues. The receptor couples with G proteins to transmit extracellular signals into the cells facilitating various cellular processes.
Biological function summary

GPR84 modulates immune responses and is involved in inflammation. It does not form a complex with other proteins but interacts independently to regulate the production of pro-inflammatory cytokines. The receptor has gained attention for its role in immune response specifically how it aids cells to react to fatty acids influencing both metabolism and inflammation.

Pathways

GPR84 participates in the lipid signaling pathway playing a role in fatty acid metabolism and immune regulation. It closely interacts with lipid molecules which activate the signaling cascades within inflammatory and metabolic contexts. Among related proteins it connects with other receptors such as GPR120 which is also involved in fatty acid signaling and inflammatory responses.

GPR84 has been implicated in the progression of inflammatory bowel disease (IBD) and multiple sclerosis. Its role in mediating inflammation ties it to other inflammatory proteins such as TNF-α a critical cytokine in these diseases. By influencing inflammatory responses GPR84 becomes a potential target for therapeutic interventions aimed at managing such immune-related disorders.

Specifications

Form

Liquid

General info

Function

G protein-coupled receptor that responds endogenously to dietary fatty acids or nutrient, specifically medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10 : 0), undecanoic acid (C11 : 0) and lauric acid (C12 : 0) are the most potent agonists (PubMed : 16966319). In immune cells, functions as a pro-inflammatory receptor via 6-OAU and promotes the expression of pro-inflammatory mediators such as TNFalpha, IL-6 and IL-12B as well as stimulating chemotactic responses through activation of signaling mediators AKT, ERK and NF-kappa-B (By similarity). In addition, triggers increased bacterial adhesion and phagocytosis in macrophages and regulates pro-inflammatory function via enhancing NLRP3 inflammasome activation (By similarity). Plays also an important role in inflammation by modulating neutrophil functions (By similarity). Mechanistically, promotes neutrophil chemotaxis, reactive oxygen species (ROS) production and degranulation via LYN-AKT/ERK pathway (By similarity). To regulate ROS, communicates with the two formyl peptide receptors FPR2 and FPR1 to control the NADPH oxidase activity in neutrophils (PubMed : 33789297).

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

Phosphorylated by a subset of GPR84-activating ligands. Constitutively phosphorylated at Ser-221 and Ser-224 in the absence of 2-HTP. By contrast, Thr-263 and Thr-264 are phosphorylated only following prior cell treatment with 2-HTP.

Product protocols

Target data

G protein-coupled receptor that responds endogenously to dietary fatty acids or nutrient, specifically medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10 : 0), undecanoic acid (C11 : 0) and lauric acid (C12 : 0) are the most potent agonists (PubMed : 16966319). In immune cells, functions as a pro-inflammatory receptor via 6-OAU and promotes the expression of pro-inflammatory mediators such as TNFalpha, IL-6 and IL-12B as well as stimulating chemotactic responses through activation of signaling mediators AKT, ERK and NF-kappa-B (By similarity). In addition, triggers increased bacterial adhesion and phagocytosis in macrophages and regulates pro-inflammatory function via enhancing NLRP3 inflammasome activation (By similarity). Plays also an important role in inflammation by modulating neutrophil functions (By similarity). Mechanistically, promotes neutrophil chemotaxis, reactive oxygen species (ROS) production and degranulation via LYN-AKT/ERK pathway (By similarity). To regulate ROS, communicates with the two formyl peptide receptors FPR2 and FPR1 to control the NADPH oxidase activity in neutrophils (PubMed : 33789297).
See full target information GPR84

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com