JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB157288

Recombinant human Granzyme A protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human Granzyme A protein is a Human Full Length protein, in the 29 to 262 aa range with >=98% purity and suitable for SDS-PAGE and Functional studies. The predicted molecular weight of ab157288 protein is 52 kDa.

- Save time and ensure accurate results - use our recombinant Granzyme A protein as a control

View Alternative Names

CTLA3, HFSP, GZMA, Granzyme A, CTL tryptase, Cytotoxic T-lymphocyte proteinase 1, Fragmentin-1, Granzyme-1, Hanukkah factor, H factor, HF

Key facts

Purity

>98% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific Activity: ~110U/μg protein. One unit is defined as the amount of enzyme that hydrolyzes 1nmol Z-Lys-SBzl per min. at 25°C in 0.05M TRIS, pH 8.0, containing 0.15M NaCl, 0.01% Triton X-100 and 0.3mM DTNB.

Accession

P12544

Animal free

No

Carrier free

No

Species

Human

Storage buffer

Constituents: 10% Glycerol (glycerin, glycerine), 3.04% Sodium chloride, 0.98% MES

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our bioactive recombinant human Granzyme A protein ab157288 as a positive control in SDS-PAGE. The rGranzyme A molecular weight is ~52 kDa (monomer).

Do not dilute to more than 0.2 mg/ml. Do not store dilute solutions (1-1000 ng/ml) for more than 24 hours.


Check out our protein gel staining guide for SDS-PAGE here

Sequence info

[{"sequence":"IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV","proteinLength":"Full Length","predictedMolecularWeight":"52 kDa","actualMolecularWeight":null,"aminoAcidEnd":262,"aminoAcidStart":29,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P12544","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Granzyme A also known as CTLA3 or GZMA is a serine protease with a role in immune cell-mediated cytotoxicity. It has a molecular weight of approximately 27 kDa. This protein is primarily expressed in the granules of cytotoxic T lymphocytes (CTLs) and natural killer (NK) cells. Granzyme A gets released into the immunological synapse upon recognition of target cells by these immune cells facilitating the induction of target cell death.
Biological function summary

Functions of Granzyme A extend to inducing apoptosis in target cells alongside its role in promoting inflammation. It operates independent of caspases and directly cleaves substrates in the cell to induce cell death making it different from the related Granzyme B. As part of the granzyme-perforin complex it enters target cells via perforin-created pores mediates reactions leading to substrate degradation and promotes DNA damage.

Pathways

Granzyme A gets involved in the granule exocytosis pathway which constitutes an important mechanism for CTLs and NK cells to kill infected or cancerous cells. The protein is also linked to the inflammatory response pathways where it can interact with other serine proteases. Related proteins like perforin and Granzyme B also engage in these pathways and they collectively work to trigger apoptosis and modulate immune responses.

Impairments or dysregulation of Granzyme A function can contribute to autoimmune diseases and certain viral infections. Autoimmune diseases such as lupus may demonstrate altered levels or activity of Granzyme A associated with tissue damage and inflammation. During viral infections Granzyme A in conjunction with perforin and Granzyme B aids in eliminating infected cells but alterations in this balance could lead to ineffective immune responses or excessive tissue damage.

Specifications

Form

Liquid

General info

Function

Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse (PubMed : 12819770, PubMed : 32299851, PubMed : 3257574, PubMed : 3262682, PubMed : 3263427). It cleaves after Lys or Arg (PubMed : 12819770, PubMed : 32299851). Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-B (GSDMB), releasing the pore-forming moiety of GSDMB, thereby triggering pyroptosis and target cell death (PubMed : 32299851, PubMed : 34022140, PubMed : 36157507, PubMed : 36899106). Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity (PubMed : 12524539). Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (PubMed : 11555662, PubMed : 12628186, PubMed : 16818237).

Sequence similarities

Belongs to the peptidase S1 family. Granzyme subfamily.

Product protocols

Target data

Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse (PubMed : 12819770, PubMed : 32299851, PubMed : 3257574, PubMed : 3262682, PubMed : 3263427). It cleaves after Lys or Arg (PubMed : 12819770, PubMed : 32299851). Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-B (GSDMB), releasing the pore-forming moiety of GSDMB, thereby triggering pyroptosis and target cell death (PubMed : 32299851, PubMed : 34022140, PubMed : 36157507, PubMed : 36899106). Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity (PubMed : 12524539). Cleaves the nucleosome assembly protein SET after 'Lys-189', which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (PubMed : 11555662, PubMed : 12628186, PubMed : 16818237).
See full target information GZMA

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Experimental & molecular medicine 56:2631-2641 PubMed39617789

2024

Distribution and impact of p16 senescent cells in elderly tissues: a focus on senescent immune cell and epithelial dysfunction.

Applications

Unspecified application

Species

Unspecified reactive species

Soon Sang Park,Young-Kyoung Lee,Young Hwa Kim,So Hyun Park,Hee Young Kang,Jin Cheol Kim,Dong Jun Kim,Su Bin Lim,Gyesoon Yoon,Jang-Hee Kim,Yong Won Choi,Tae Jun Park
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com