JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB180053

Recombinant human Growth hormone receptor protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human Growth hormone receptor protein is a Human Fragment protein, in the 27 to 264 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

Growth hormone receptor, GH receptor, Somatotropin receptor, GHR

3 Images
Functional Studies - Recombinant human Growth hormone receptor protein (AB180053)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Growth hormone receptor protein (AB180053)

Immobilized Human GH, Tag Free Recombinant Human Growth Hormone Protein ab223106 at 2 μg/mL (100 μL/well) can bind Human GHR, His Tag (ab180053) with a linear range of 1-8 ng/mL (QC tested).

SDS-PAGE - Recombinant human Growth hormone receptor protein (AB180053)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human Growth hormone receptor protein (AB180053)

Human GHR (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.

SDS-PAGE - Recombinant human Growth hormone receptor protein (AB180053)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Growth hormone receptor protein (AB180053)

SDS-PAGE analysis of ab180053 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 40-50 kDa due to glycosylation.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA. Immobilized Human GH, Tag Free at 2μg/mL (100 μL/well) can bind Human GHR, His Tag (ab180053) with a linear range of 1-8 ng/mL (QC tested).

Accession

P10912

Animal free

No

Carrier free

No

Species

Human

Reconstitution

It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. To avoid surface adsorption loss and inactivation the reconstituted protein must not be aliquoted to less than 10 µg per vial.

Storage buffer

pH: 7.4 Constituents: PBS, 10% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY","proteinLength":"Fragment","predictedMolecularWeight":"28.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":264,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P10912","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
Up to 12 months
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle|For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA)
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Growth Hormone Receptor (GHR) also known as somatotropin receptor is a vital protein that mediates the effects of growth hormone (GH). GHR is a transmembrane receptor with a mass of approximately 70 kDa and is expressed in many tissues including liver muscle and adipose tissue. It plays an important role in growth regulation by binding to growth hormone which triggers signal transduction pathways involved in cellular proliferation and growth.
Biological function summary

The growth hormone receptor facilitates the hormone's ability to promote growth and cell differentiation. The receptor when activated stimulates the JAK2/STAT5 signaling pathway a part of a larger GHR complex. This complex leads to gene transcription that stimulates growth and metabolism. The activation of GHR has significant effects on the cellular functions related to protein synthesis lipid metabolism and glucose metabolism.

Pathways

The growth hormone receptor is an important component of the JAK-STAT signaling pathway and the mTOR signaling pathway. In these pathways GHR interacts with other proteins such as Janus kinase 2 (JAK2) and signal transducer and activator of transcription 5 (STAT5). These interactions play a critical role in translating the binding of growth hormone into cellular responses that lead to growth and metabolic regulation.

Disruptions or mutations in the growth hormone receptor can lead to conditions such as Laron syndrome and growth hormone insensitivity. These conditions often display symptoms of dwarfism and metabolic aberrations due to impaired signaling. GHR malfunction relates closely to growth hormone (GH) and anti-growth hormone treatments like somatropin used for managing growth deficiencies. The connection of GHR with related pathways and proteins like the IGF-1 (Insulin-like Growth Factor 1) underlines its role in metabolic diseases.

Specifications

Form

Lyophilized

Additional notes

Purified by Immobilized metal affinity chromatography.

General info

Function

Receptor for pituitary gland growth hormone (GH1) involved in regulating postnatal body growth (PubMed : 1549776, PubMed : 2825030, PubMed : 8943276). On ligand binding, couples to the JAK2/STAT5 pathway (PubMed : 1549776, PubMed : 15690087, PubMed : 2825030, PubMed : 8943276).. Growth hormone-binding protein. The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.. Isoform 2. Up-regulates the production of the soluble Growth hormone-binding protein form (GHBP) and acts as a negative inhibitor of growth hormone signaling.

Sequence similarities

Belongs to the type I cytokine receptor family. Type 1 subfamily.

Post-translational modifications

The soluble form (GHBP) is produced by phorbol ester-promoted proteolytic cleavage at the cell surface (shedding) by ADAM17/TACE (PubMed:11785980). Shedding is inhibited by growth hormone (GH) binding to the receptor probably due to a conformational change in GHR rendering the receptor inaccessible to ADAM17 (By similarity).. On GH binding, phosphorylated on tyrosine residues in the cytoplasmic domain by JAK2.. Ubiquitinated by the ECS(SOCS2) complex following ligand-binding and phosphorylation by JAK2, leading to its degradation by the proteasome (PubMed:21980433, PubMed:25505247, PubMed:31182716, PubMed:34857742). Regulation by the ECS(SOCS2) complex acts as a negative feedback loop of growth hormone receptor signaling (PubMed:21980433). Ubiquitination is not sufficient for GHR internalization (By similarity).

Product protocols

Target data

Receptor for pituitary gland growth hormone (GH1) involved in regulating postnatal body growth (PubMed : 1549776, PubMed : 2825030, PubMed : 8943276). On ligand binding, couples to the JAK2/STAT5 pathway (PubMed : 1549776, PubMed : 15690087, PubMed : 2825030, PubMed : 8943276).. Growth hormone-binding protein. The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.. Isoform 2. Up-regulates the production of the soluble Growth hormone-binding protein form (GHBP) and acts as a negative inhibitor of growth hormone signaling.
See full target information GHR

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

PloS one 18:e0282741 PubMed36952491

2023

Amino acid substitutions in human growth hormone affect secondary structure and receptor binding.

Applications

Unspecified application

Species

Unspecified reactive species

Andrei Rajkovic,Sandesh Kanchugal,Eldar Abdurakhmanov,Rebecca Howard,Sebastian Wärmländer,Joseph Erwin,Hugo A Barrera Saldaña,Astrid Gräslund,Helena Danielson,Samuel Coulbourn Flores
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com