JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB95471

Recombinant Human GRX2 protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human GRX2 protein (His tag C-Terminus) is a Human Full Length protein, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

GRX2, CGI-133, GLRX2

1 Images
SDS-PAGE - Recombinant Human GRX2 protein (His tag C-Terminus) (AB95471)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human GRX2 protein (His tag C-Terminus) (AB95471)

15% SDS-PAGE analysis of 3μg ab95471.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9NS18

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.00174% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Glutaredoxin 2.

Sequence info

[{"sequence":"MSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQLEHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NS18","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target GRX2 also commonly known as GLRX2 is a human protein encoded by the GLRX2 gene. GRX2 functions as a glutaredoxin a type of enzyme involved in the process of reducing disulfide bonds in proteins which is essential for cell redox regulation. The protein has a molecular mass of approximately 16 kDa and primarily resides in the mitochondria and cytoplasm of cells. Its expression occurs in various tissues with significant levels in the heart brain and skeletal muscle indicating its broad functional roles across different organ systems.
Biological function summary

The GRX2 protein plays a critical role in maintaining cellular redox balance by facilitating the reversible oxidation of protein cysteines. This is important for protecting cells against oxidative stress. GRX2 does not function as an isolated entity but instead forms part of larger multi-protein complexes interacting with other enzymes to regulate cellular homeostasis. These interactions help to protect cells from oxidative damage promote protein folding and regenerate other antioxidants.

Pathways

GRX2 holds a significant position in the redox regulation and antioxidant pathways. It partners with thioredoxin reductase and glutathione systems to mediate these pathways and manage cellular oxidative stress. The protein's activity is closely tied to glutathione with GRX2 often acting in synergy with glutathione to reduce complex oxidized protein thiols. This collaboration is vital in the oxidative stress response where the pathway elements must efficiently counterbalance oxidative challenges.

GRX2's function links it to several oxidative stress-related conditions including neurodegenerative diseases and cardiovascular disorders. In neurodegenerative diseases like Parkinson's disease GRX2's ability to combat oxidative stress is compromised leading to neuronal damage. Additionally the protein's interaction with other redox regulatory proteins such as thioredoxin suggests interconnected roles in the progression of these disorders. Cardiovascular diseases also involve GRX2 due to its essential function in maintaining cardiovascular integrity under environmental and metabolic oxidative stress.

Specifications

Form

Liquid

Additional notes

ab95471 was purified by using conventional chromatography.

General info

Function

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.

Sequence similarities

Belongs to the glutaredoxin family.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.
See full target information GLRX2

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cell chemical biology 26:366-377.e12 PubMed30661989

2019

Frenolicin B Targets Peroxiredoxin 1 and Glutaredoxin 3 to Trigger ROS/4E-BP1-Mediated Antitumor Effects.

Applications

Unspecified application

Species

Unspecified reactive species

Qing Ye,Yinan Zhang,Yanan Cao,Xiachang Wang,Yubin Guo,Jing Chen,Jamie Horn,Larissa V Ponomareva,Luksana Chaiswing,Khaled A Shaaban,Qiou Wei,Bradley D Anderson,Daret K St Clair,Haining Zhu,Markos Leggas,Jon S Thorson,Qing-Bai She
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com