JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152884

Recombinant Human GST-1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human GST-1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 168 to 267 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Carbohydrate sulfotransferase 1, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, Keratan sulfate Gal-6 sulfotransferase, GST-1, KS6ST, KSGal6ST, KSST, CHST1

1 Images
SDS-PAGE - Recombinant Human GST-1 protein (GST tag N-Terminus) (AB152884)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human GST-1 protein (GST tag N-Terminus) (AB152884)

12.5% SDS-PAGE analysis of ab152884 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

O43916

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Carbohydrate sulfotransferase 1.

Sequence info

[{"sequence":"PPGPADLVLEEGDCVRKCGLLNLTVAAEACRERSHVAIKTVRVPEVNDLRALVEDPRLNLKVIQLVRDPRGILASRSETFRDTYRLWRLWYGTGRKPYNL","proteinLength":"Fragment","predictedMolecularWeight":"36.74 kDa","actualMolecularWeight":null,"aminoAcidEnd":267,"aminoAcidStart":168,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O43916","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

GST-1 also known as Glutathione S-transferase 1 is an enzyme with a molecular mass of around 26 kDa. This target works mechanically by catalyzing the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. GST-1 shows expression in various tissues including the liver which is a major site for drug metabolism. It also plays a role in antioxidant defense helping to protect cells from damage by reactive oxygen species (ROS).
Biological function summary

Within cellular contexts GST-1 performs critical functions related to the body's ability to handle oxidative stress. This enzyme does not typically operate as part of a larger complex but works individually or in collaboration with other GST isoenzymes. It contributes to the detoxification processes by neutralizing harmful compounds and maintaining cellular health. GST-1 also impacts the bioavailability and breakdown of hormones drugs and other xenobiotics.

Pathways

GST-1 plays significant roles within oxidative stress response and detoxification pathways. It participates in the pathway that involves glutathione metabolism protecting cells from oxidative damage. GST-1 acts in conjunction with other antioxidant proteins like superoxide dismutase (SOD) and catalase working together to effectively minimize ROS levels. This cooperation helps maintain cellular homeostasis and prevents damage that can lead to various pathological conditions.

GST-1 shows associations with cancer and neurodegenerative disorders. Alterations in GST-1 expression levels can influence the susceptibility to certain cancers including liver and lung cancers where detoxification capacity becomes compromised. In neurodegenerative disorders like Parkinson's disease GST-1 plays a protective role where its interaction with other GST isoenzymes could potentially affect neuronal survival. Understanding these connections helps in exploring therapeutic interventions for managing oxidative stress-related diseases.

Specifications

Form

Liquid

General info

Function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of internal galactose (Gal) residues of keratan. Cooperates with B4GALT4 and B3GNT7 glycosyltransferases and CHST6 sulfotransferase to construct and elongate disulfated disaccharide unit [->3(6-sulfoGalbeta)1->4(6-sulfoGlcNAcbeta)1->] within keratan sulfate polymer (PubMed : 10642612, PubMed : 17690104, PubMed : 9405439). Has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer (PubMed : 9405439). Involved in biosynthesis of phosphacan, a major keratan sulfate proteoglycan in the developing brain (By similarity). Involved in biosynthesis of 6-sulfoGalbeta-containing O-linked glycans in high endothelial venules of lymph nodes. May act in a synergistic manner with CHST4 to generate sialyl 6',6-disulfo Lewis X motif, a recognition determinant for immune cell receptors implicated in leukocyte trafficking (PubMed : 10330415). Catalyzes sulfation of N-acetyllactosamine (LacNAc) oligosaccharides with highest efficiency for sialylated LacNAc structures (PubMed : 10642612).

Sequence similarities

Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.

Product protocols

Target data

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of internal galactose (Gal) residues of keratan. Cooperates with B4GALT4 and B3GNT7 glycosyltransferases and CHST6 sulfotransferase to construct and elongate disulfated disaccharide unit [->3(6-sulfoGalbeta)1->4(6-sulfoGlcNAcbeta)1->] within keratan sulfate polymer (PubMed : 10642612, PubMed : 17690104, PubMed : 9405439). Has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer (PubMed : 9405439). Involved in biosynthesis of phosphacan, a major keratan sulfate proteoglycan in the developing brain (By similarity). Involved in biosynthesis of 6-sulfoGalbeta-containing O-linked glycans in high endothelial venules of lymph nodes. May act in a synergistic manner with CHST4 to generate sialyl 6',6-disulfo Lewis X motif, a recognition determinant for immune cell receptors implicated in leukocyte trafficking (PubMed : 10330415). Catalyzes sulfation of N-acetyllactosamine (LacNAc) oligosaccharides with highest efficiency for sialylated LacNAc structures (PubMed : 10642612).
See full target information CHST1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com