JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB268643

Recombinant human GTPase HRAS protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human GTPase HRAS protein (Active) is a Human Full Length protein, in the 2 to 186 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

HRAS1, HRAS, GTPase HRas, H-Ras-1, Ha-Ras, Transforming protein p21, c-H-ras, p21ras

2 Images
Functional Studies - Recombinant human GTPase HRAS protein (Active) (AB268643)
  • FuncS

Supplier Data

Functional Studies - Recombinant human GTPase HRAS protein (Active) (AB268643)

The specific activity of ab268643 was determined to be 2 nmol/min/mg in GTPase-Glo assay using HRAS1.

SDS-PAGE - Recombinant human GTPase HRAS protein (Active) (AB268643)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human GTPase HRAS protein (Active) (AB268643)

SDS-PAGE analysis of ab268643.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The specific activity of ab268643 was determined to be 2 nmol/min/mg in GTPase-Glo assay using HRAS1.

Accession

P01112

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.74% Sodium chloride, 0.82% Sodium phosphate, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":186,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01112","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

GTPase HRAS also known as H-RAS or HRAS1 is a small GTPase enzyme involved in intracellular signal transduction. It has a molecular mass of approximately 21 kDa. HRAS is widely expressed in various tissues and plays a role in regulating cell growth and differentiation. The HRAS protein functions as a molecular switch cycling between an active GTP-bound state and an inactive GDP-bound state. This activity is facilitated by the HRAS protein's intrinsic GTPase activity which hydrolyzes GTP to GDP.
Biological function summary

GTPase HRAS participates in the regulation of cell proliferation differentiation and survival serving as an essential component of several signal transduction complexes. HRAS interacts with various signaling molecules and pathways to mediate mitogenic signals. Through these interactions the HRAS protein modulates cellular responses to extracellular stimuli influencing processes like growth and division playing an important role in maintaining normal cellular functions.

Pathways

The involvement of GTPase HRAS in the MAPK/ERK and the PI3K/AKT pathways illustrates its importance in transmitting signals from cell surface receptors. These pathways control a variety of cellular functions including growth survival and metabolism. HRAS interacts with related proteins like KRAS and NRAS integral members of the RAS family. These interactions highlight its role in signaling cascades that contribute to the cellular response to growth factors.

Mutations and aberrant activation of GTPase HRAS link to oncogenic processes particularly in bladder and thyroid cancers. The mutated HRAS protein contributes to the unchecked cellular proliferation seen in tumorigenesis. Additionally HRAS mutations associate with developmental disorders such as Costello syndrome where aberrant signaling disrupts normal developmental processes. HRAS-related pathways often involve other RAS family members like KRAS underlining their collective impact in disease states.

Specifications

Form

Liquid

General info

Function

Involved in the activation of Ras protein signal transduction (PubMed : 22821884). Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed : 12740440, PubMed : 14500341, PubMed : 9020151).

Sequence similarities

Belongs to the small GTPase superfamily. Ras family.

Post-translational modifications

Palmitoylated by the ZDHHC9-GOLGA7 complex. A continuous cycle of de- and re-palmitoylation regulates rapid exchange between plasma membrane and Golgi.. S-nitrosylated; critical for redox regulation. Important for stimulating guanine nucleotide exchange. No structural perturbation on nitrosylation.. The covalent modification of cysteine by 15-deoxy-Delta12,14-prostaglandin-J2 is autocatalytic and reversible. It may occur as an alternative to other cysteine modifications, such as S-nitrosylation and S-palmitoylation.. Acetylation at Lys-104 prevents interaction with guanine nucleotide exchange factors (GEFs).. Fatty-acylated at Lys-170.. Ubiquitinated by the BCR(LZTR1) E3 ubiquitin ligase complex at Lys-170 in a non-degradative manner, leading to inhibit Ras signaling by decreasing Ras association with membranes.. (Microbial infection) Glucosylated at Thr-35 by P.sordellii toxin TcsL (PubMed:19744486, PubMed:8626575, PubMed:8626586, PubMed:9632667). Monoglucosylation completely prevents the recognition of the downstream effector, blocking the GTPases in their inactive form, leading to inhibit Ras signaling (PubMed:8626575, PubMed:8626586, PubMed:9632667).

Product protocols

Target data

Involved in the activation of Ras protein signal transduction (PubMed : 22821884). Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed : 12740440, PubMed : 14500341, PubMed : 9020151).
See full target information HRAS

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com